Details for Arabidopsis Locus AT3G22080

Position : Chr3 ( 5`- 7777818 .. 7781718 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22080

Protein [Map View]
MGSTVLDANPSTLREHPPSSYSIKFENIAELDDGKYESSLFAAGGYNWRLVIYPKGNAKDEGSGFISMYVEIDSTNLLSS
PLTGVFAYLVFFVYNKKTDKYFTIKGLYISNIFHIYIDLLLVCFPFSIHSLLVFFTHRQFMHDVIDSELKRFNAFRTGDQ
CEFGVDVLVAPSLTKWEVVSFNQKILDPKFSWSLKKFKELKEELYNSDKFLVGGRQWFLKVHPKGVKARDNSLSIYVYLS
ESETLNAEEKIYTRVHLRVLDPFGSIHQAGQCNFWRTNTNKNQGYGWPTFASLDKVREKYLDNEGSLNIEIEFAVVSSTK
YSPILILSSLASGSMMCSSVSSTTLRSWRERTPNSYSLKLQNISQVEKSTLFSDGKYQSRLFSSGGYNWRMIIYPKGNRK
DDGSGFISMYVEIDSTSLLTTPTTEVFADLRFFVFNKKENKYYTIQHVESKLFNAFRTIWGLAQVLPVDTFTDPKNGYIF
EGDQCEFGVDVIVAAPPTNWEIHTLHEALSQPKFFWTVKNFSELNNNVYTSGNFSMRERKWVLKLYPKGDVKGDRKWLSL
YLYLDQSETLKESEKIFVQAQLRVLDPRGSNHVTHKISSWYTSSNTAWGYRKFVSLAEIPKAYLDKDTLKVQIDVEVVSE
AEFSPSMI*

DNA
ATGGGCAGCACCGTCTTGGACGCAAACCCGTCAACCTTAAGAGAACATCCACCTTCCTCATATTCCATCAAGTTTGAGAA
TATCGCAGAACTCGACGATGGCAAATACGAATCTAGTCTTTTCGCAGCTGGCGGGTACAACTGGAGATTGGTCATTTATC
CAAAAGGAAACGCAAAAGACGAAGGGAGTGGATTTATTTCAATGTATGTGGAGATTGATAGCACAAACCTCTTGTCATCA
CCACTAACTGGCGTGTTTGCGTATCTCGTATTCTTTGTCTACAACAAGAAAACAGACAAATACTTTACTATTAAAGGTTT
GTATATATCTAATATATTTCACATATACATTGATCTATTGCTAGTTTGTTTTCCATTTAGTATACATTCACTTCTCGTTT
TCTTTACTCATCGACAATTTATGCACGATGTCATAGATTCAGAACTGAAGCGGTTCAATGCATTTAGAACGGGAGATCAA
TGTGAATTTGGTGTTGATGTTCTGGTTGCTCCATCCCTTACTAAATGGGAAGTCGTGTCCTTTAATCAGAAAATCCTTGA
TCCCAAGTTCTCGTGGTCTCTCAAGAAATTTAAAGAGTTAAAAGAGGAGTTATACAACTCAGACAAGTTTTTAGTAGGAG
GAAGGCAATGGTTTCTAAAGGTGCATCCTAAGGGTGTTAAAGCACGAGACAACTCGTTATCCATTTATGTGTATTTAAGT
GAAAGTGAAACACTCAATGCAGAGGAGAAAATCTACACGCGAGTACATCTTAGAGTTTTAGATCCGTTTGGATCCATTCA
CCAAGCCGGGCAATGCAACTTCTGGCGCACAAATACAAATAAAAACCAAGGCTATGGTTGGCCTACTTTTGCGTCTTTAG
ATAAAGTGCGAGAGAAGTACTTGGACAATGAGGGTTCTTTGAACATAGAGATTGAATTTGCAGTTGTTTCTAGCACCAAA
TACTCTCCTATTCTGATTCTCTCTAGTCTCGCTTCAGGTTCAATGATGTGTTCAAGCGTATCTTCAACAACTCTTCGAAG
CTGGAGAGAACGTACTCCTAATTCTTACTCACTCAAGCTCCAAAACATCTCCCAAGTCGAGAAATCAACTCTCTTCTCTG
ATGGCAAGTATCAATCCCGTCTTTTCTCCTCTGGTGGATACAACTGGAGAATGATCATATACCCGAAAGGGAATCGCAAA
GACGATGGAAGTGGGTTTATTTCAATGTATGTTGAAATAGATAGCACAAGCCTTTTGACTACACCTACCACTGAGGTGTT
TGCCGATCTACGGTTTTTCGTATTTAACAAAAAAGAAAATAAGTACTATACTATTCAACATGTAGAGTCGAAGCTATTCA
ATGCATTCAGAACAATATGGGGATTGGCGCAAGTGCTTCCAGTTGATACATTCACTGATCCTAAAAACGGATATATTTTT
GAGGGAGATCAATGCGAGTTTGGTGTTGATGTCATTGTTGCTGCACCTCCTACTAATTGGGAAATTCACACTTTACATGA
AGCACTAAGTCAACCCAAGTTCTTTTGGACGGTCAAGAATTTCTCTGAGCTGAACAATAATGTTTACACATCAGGCAATT
TTTCGATGAGAGAAAGGAAATGGGTTCTAAAGTTGTATCCCAAGGGGGACGTAAAAGGAGACCGAAAATGGTTATCCCTT
TATCTATATCTCGATCAAAGTGAAACACTAAAGGAAAGTGAAAAGATTTTCGTGCAAGCTCAATTGCGAGTTTTAGACCC
ACGTGGATCCAATCACGTGACACACAAAATTTCGTCTTGGTACACCAGCTCAAATACGGCTTGGGGATACAGAAAATTTG
TGTCTCTAGCTGAAATTCCTAAAGCTTACTTGGACAAGGACACTTTAAAAGTGCAGATTGATGTTGAAGTTGTTTCTGAA
GCAGAATTCTCTCCTTCCATGATTTAA