Details for Arabidopsis Locus AT3G22060

Position : Chr3 ( 5`- 7771016 .. 7772340 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22060

Protein [Map View]
MSSLKRIVWFPILAIAIQILSIHTVLSQSQNNAFLFHKCSDIEGSFTSKSLYESNLNNLFSQLSYKVPSTGFAASSTGNT
PNNVNGLALCRGDASSSDCRSCLETAIPELRQRCPNNKAGIVWYDNCLVKYSSTNFFGKIDFENRFYLYNVKNVSDPSTF
NSQTKALLTELTKKATTRDNQKLFATGEKNIGKNKLYGLVQCTRDLKSITCKACLNGIIGELPNCCDGKEGGRVVGGSCN
FRYEIYPFVKTA*

DNA
ATGTCTTCATTAAAACGCATCGTTTGGTTCCCTATCTTGGCCATAGCCATACAAATTCTCTCTATACATACCGTTTTGTC
TCAAAGCCAGAACAATGCGTTTCTCTTCCACAAGTGCTCAGACATCGAAGGAAGCTTTACCTCAAAAAGTCTCTACGAGT
CAAATCTCAACAATCTCTTTAGTCAGCTCTCTTACAAAGTTCCATCCACCGGTTTTGCCGCCTCCTCCACTGGCAACACT
CCAAACAACGTCAACGGTTTGGCCCTTTGCCGCGGTGATGCCTCCTCCTCTGACTGCCGCTCTTGTCTTGAGACTGCCAT
CCCCGAGCTACGTCAGAGATGTCCGAACAACAAGGCGGGAATAGTATGGTATGACAACTGTCTTGTAAAGTATTCCTCGA
CCAATTTCTTCGGGAAGATAGATTTCGAGAACAGGTTCTATTTGTACAACGTCAAAAATGTGAGTGATCCATCAACATTC
AACTCGCAGACGAAAGCTCTTTTAACCGAGCTGACAAAGAAAGCGACTACTAGAGATAACCAGAAGCTATTTGCGACAGG
AGAGAAAAATATCGGAAAGAATAAATTGTACGGACTAGTGCAATGTACGAGGGACTTGAAGAGTATTACTTGTAAGGCGT
GTTTAAATGGAATTATTGGGGAGCTTCCTAACTGTTGCGACGGTAAAGAAGGAGGGAGAGTTGTGGGTGGGAGCTGTAAC
TTTAGGTATGAGATTTACCCTTTTGTTAAGACTGCTTGA