Details for Arabidopsis Locus AT3G22057

Position : Chr3 ( 5`- 7769346 .. 7770261 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22057

Protein [Map View]
MNKTMYSSYSLSKRLVSIPILAIQLLLIRSVSSLNLTNDYLNHKCLVSQGKYRPGDKYEDNLNFLTRECRGDSYDSKCLS
CYATALSGIIPKEERLKECFLYAQPKQHDRGHGIVQQENKGFPLRAHAGSHYTQQDNDALRSRGEEARDKEIVCNGTVCA
RHIAMKGLFGMEYQ*

DNA
ATGAACAAAACAATGTACTCTTCATATTCTTTATCCAAACGTCTTGTTTCTATCCCTATCTTGGCTATACAACTCCTTCT
CATACGCAGTGTCTCGTCACTGAACCTTACCAATGACTATCTTAACCACAAATGCCTCGTCAGTCAAGGGAAATATAGGC
CTGGAGATAAGTACGAGGACAACCTCAACTTTCTCACCCGTGAATGCCGCGGCGACTCCTACGACTCCAAGTGCCTCTCC
TGCTATGCCACCGCCCTTTCCGGGATCATCCCCAAGGAAGAACGATTAAAGGAATGTTTTCTCTATGCACAACCCAAACA
ACATGATCGAGGACACGGAATTGTTCAACAAGAAAACAAGGGATTTCCTCTACGAGCTCATGCTGGAAGCCACTACACCC
AACAGGACAATGATGCTTTACGCAGCAGGGGAGAAGAAGCTAGGGACAAAGAAATTGTATGCAATGGTACAGTGTGCGCA
AGACATATTGCGATGAAAGGGTTGTTTGGAATGGAGTATCAATGA