Details for Arabidopsis Locus AT3G22040

Position : Chr3 ( 5`- 7761807 .. 7762675 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22040

Protein [Map View]
MYSSYSLSKCLVSFHILAIQLFIPSVASLNLTNVYLHHKCRVGQGKYHPGSRYEKDFDSLTSFVAANKFIDGFVHSSNSD
GPNSTTIIFQCRGDSYKSNCRTCYDTALAGFRKRCPRNKGGIIWYDQCFLDVSMINDLAPRKINYKDTFAMHNPNNVRGD
TKMFSKKTNDFLQQLIVKADKPDMDGVELLYYAAGEMRIGREKLHAMVQCAKDLADCKSCLEWSFKELSKCCDGKRGARF
LGTSCNLRYELYPFLRT*

DNA
ATGTACTCTTCATATTCTCTATCCAAATGCCTCGTTTCTTTCCATATCTTGGCCATACAACTCTTCATACCTAGCGTTGC
ATCACTGAATCTTACAAATGTGTACCTTCACCACAAATGCCGGGTTGGTCAAGGTAAATACCACCCGGGAAGTAGATACG
AGAAAGACTTCGACTCTCTCACCAGTTTCGTCGCTGCTAATAAGTTTATAGATGGGTTCGTACACAGCTCTAATAGTGAC
GGTCCCAATTCCACTACCATCATATTCCAGTGTCGTGGTGACTCTTACAAGTCTAACTGTCGAACCTGCTATGACACCGC
TCTGGCCGGGTTTCGTAAGAGATGTCCAAGAAACAAAGGTGGAATAATATGGTACGACCAATGTTTTCTCGATGTTAGTA
TGATCAATGACCTAGCCCCAAGGAAGATCAATTACAAGGATACTTTTGCTATGCACAACCCAAACAATGTGAGGGGGGAT
ACAAAGATGTTCAGCAAGAAGACAAATGATTTCCTCCAACAGCTGATTGTGAAAGCTGATAAACCCGACATGGACGGCGT
CGAGTTGTTATATTATGCGGCGGGAGAGATGAGAATCGGGAGGGAAAAACTGCATGCGATGGTGCAGTGTGCGAAAGACC
TAGCGGACTGTAAGTCTTGTTTGGAATGGAGTTTCAAGGAGCTTTCTAAGTGCTGCGACGGTAAACGAGGAGCGAGATTT
TTGGGTACAAGCTGTAATCTTAGGTATGAGCTATATCCTTTTCTTAGGACTTGA