Details for Arabidopsis Locus AT3G22030

Position : Chr3 ( 5`- 7759317 .. 7760738 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22030

Protein [Map View]
MFSSYSLCKCLVSFHILAIQVLISCASSLNLTNEYLNHKCRVIKENTNQEVSTRKNSTLSAVELLPLTLQMVSHTGPIVE
IPNLSPSYSNVAVTLTGPSATPAMLPPSPGCPRNKGGIIWYDQCFLDVSMINDNSPRRMNYDNIFSMHNPNNVRGNVNSF
NKKTTEFLYKLIGKADRLDVDGINFLYYAAGEMRLGKQTLFAMVQCAKDILSCKDCLEWSIKELSKCCDGKQGARVVGTI
CNLRYELYPFLRT*

DNA
ATGTTCTCTTCATATTCTCTATGCAAATGCCTCGTTTCTTTCCATATATTGGCTATACAAGTCCTCATAAGCTGTGCGTC
TTCCTTGAATCTTACTAATGAGTATCTGAACCACAAATGTCGCGTGATCAAGGAAAATACCAACCAGGAAGTGAGTACGA
GAAAGAACTCAACACTCTCAGCCGTAGAGTTGCTACCCTTGACTTTACAGATGGTTTCACACACCGGTCCAATAGTAGAG
ATACCAAATCTGTCACCATCATATTCCAATGTCGCGGTGACTCTTACAGGTCCAAGTGCAACTCCTGCTATGCTACCGCC
CTCGCCGGGGTGTCCGAGAAACAAAGGTGGAATAATATGGTATGACCAATGTTTTCTCGATGTTAGTATGATTAATGACA
ATTCCCCAAGACGGATGAACTACGATAATATTTTTTCTATGCACAACCCAAACAACGTGAGAGGGAATGTAAACTCATTC
AACAAAAAGACGACTGAATTCCTCTACAAACTGATTGGAAAAGCTGATAGACTCGACGTGGACGGGATCAACTTTCTATA
TTACGCGGCAGGGGAAATGAGGCTTGGGAAGCAAACATTGTTTGCAATGGTGCAATGTGCGAAGGACATATTGAGTTGTA
AGGATTGTTTGGAATGGAGTATCAAGGAGCTTTCTAAGTGCTGTGATGGTAAACAAGGAGCGAGAGTTGTAGGTACAATT
TGTAATCTTAGGTATGAGCTATACCCTTTTCTTAGGACTTAA