Details for Arabidopsis Locus AT3G21980

Position : Chr3 ( 5`- 7745143 .. 7746161 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21980

Protein [Map View]
MISKFGSVHILAVVAIQLLIIPSVSSLNLTNAYLHHKCNNTEGKYSHGSAFEKYINLALRAIDSDNYLNGFAYIERGEDP
NKVFVMYQCRGDSYGSKCKSCISAAISGIDYENDFYLSNPNDVNDKELFNKETSALLEELTNKATDKNNMIGNKFVLYAA
GDKRIGTKNVYAMVQCTKDLVTTTSAACFEWIFKMFSKCCEGKQGGRVLGTSCNFRYELYPFLRN*

DNA
ATGATTTCAAAATTTGGATCGGTCCATATCTTGGCTGTGGTAGCCATACAACTCCTAATTATACCAAGCGTTTCGTCCCT
TAACCTTACAAATGCGTATTTGCACCACAAATGTAACAACACCGAAGGAAAATATAGCCACGGGAGTGCGTTTGAGAAAT
ATATCAACTTAGCTCTCCGTGCCATCGATTCAGACAATTATCTCAATGGTTTTGCCTACATCGAGAGAGGTGAGGATCCC
AATAAAGTCTTCGTCATGTACCAATGTCGCGGCGACTCCTACGGGTCTAAGTGCAAATCCTGCATAAGCGCTGCCATCTC
TGGGATTGATTACGAGAACGATTTCTATTTGTCCAACCCGAACGACGTGAACGATAAGGAGTTGTTCAACAAGGAGACCT
CGGCTCTCTTGGAGGAGCTAACAAATAAAGCCACTGATAAAAATAACATGATAGGCAATAAATTTGTGCTGTACGCGGCA
GGGGATAAGAGAATTGGAACGAAGAATGTGTATGCAATGGTGCAATGTACGAAAGACTTAGTGACTACAACTTCTGCTGC
GTGTTTCGAATGGATTTTCAAGATGTTTTCAAAGTGCTGTGAAGGAAAGCAAGGAGGGAGAGTTTTGGGTACGAGCTGTA
ACTTTAGGTATGAGTTATATCCCTTTCTTAGAAATTAA