Details for Arabidopsis Locus AT3G21970

Position : Chr3 ( 5`- 7742459 .. 7743601 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21970

Protein [Map View]
MSSNIFGSVPILVVVAIQLLLVHNVSSQNVTNDYLNHQCNNTQGRYTHGSTFEKNLNQVLHNISNLDLRYGYAYVSNVVA
YKVSKDPNIVFVLLQCRGDSFGSKCHSCLSTAVSGLRERCPGNRGATIWYDQCLLEISSVDSEGRIHYKRMFYMQNPTNV
TNDPKRFEDKRRDLLHKLMLEATKDSKENGAKGLLYAVGEMRIGRNKMYAMVQCTQDLWQTGCHVCLEWITQMKYGEFFY
RKPGGRVCGRSCSFRYELYPFLRR*

DNA
ATGTCTTCAAATATTTTTGGATCGGTCCCTATTTTGGTCGTGGTGGCTATACAACTTCTTCTTGTACACAATGTTTCTTC
CCAGAACGTTACCAATGACTATTTGAACCACCAATGCAACAACACCCAAGGGAGATACACGCATGGGAGTACGTTTGAGA
AGAACCTCAACCAAGTTCTTCATAACATCTCTAACCTCGATCTTAGATACGGTTACGCCTACGTCTCTAATGTTGTGGCT
TACAAAGTTAGCAAGGATCCCAACATTGTCTTCGTTTTGCTCCAGTGCCGCGGTGACTCCTTTGGGTCCAAATGCCACTC
CTGCCTCAGCACAGCCGTCTCTGGGCTTCGTGAGAGATGTCCAGGAAACAGAGGAGCAACAATATGGTACGACCAATGTC
TTTTGGAGATTTCTTCGGTGGATTCCGAGGGGAGGATCCATTACAAACGTATGTTCTATATGCAAAACCCGACGAACGTC
ACCAACGATCCCAAACGGTTCGAAGATAAAAGAAGGGATCTCCTCCACAAGCTAATGCTGGAAGCCACCAAGGATAGCAA
GGAAAACGGCGCCAAGGGACTGTTGTACGCAGTGGGTGAGATGAGGATTGGAAGAAATAAGATGTATGCAATGGTGCAGT
GTACGCAAGACTTATGGCAGACTGGTTGCCATGTGTGTCTAGAATGGATTACGCAGATGAAATATGGAGAGTTCTTCTAC
CGTAAACCAGGAGGGAGAGTTTGTGGTAGGAGTTGTAGCTTTAGGTATGAGCTTTACCCTTTTCTTAGAAGGTAA