Details for Arabidopsis Locus AT3G21900

Position : Chr3 ( 5`- 7715393 .. 7716343 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21900

Protein [Map View]
MYYSSPTCFVLITIFAVVVTQLIFMRTVSSLNMTNAYLNHKCLANQGKYKPGSWYEKKLQSIIVSIGSGDGFTLGYDMMA
LGKDSDYVAVTNQCRGDSNGSMCRSCFATAIARGAIIWYDQCTLQISPFDTQGKFDKDNDFCMSNKKKMNVDSFGEKWMT
FLDNLVGIALKDHLYAAGDTRFGTKKLYGMVQCRLDIYNNSCRECVGHIAVKFQDCWHGKQGARVLGSGCNFRYELYPFV
GSNKRGRNLN*

DNA
ATGTACTATTCATCGCCGACATGCTTCGTTTTGATCACTATATTTGCCGTGGTGGTAACACAACTGATCTTTATGCGCAC
CGTTTCGTCCTTGAACATGACCAATGCCTATCTGAACCACAAATGCTTAGCCAATCAAGGGAAATACAAGCCGGGAAGTT
GGTATGAGAAAAAACTCCAAAGTATTATAGTCTCTATCGGTAGCGGTGATGGTTTTACCCTTGGTTACGACATGATGGCC
CTTGGTAAGGATTCTGATTACGTAGCCGTCACCAACCAGTGCCGTGGCGACTCCAACGGGTCCATGTGCCGCTCCTGCTT
TGCCACCGCCATCGCAAGGGGGGCAATAATATGGTACGACCAATGTACTCTCCAGATTTCTCCGTTCGATACTCAAGGGA
AGTTCGACAAAGATAATGATTTCTGTATGTCCAACAAGAAGAAAATGAACGTAGATTCGTTTGGAGAGAAGTGGATGACA
TTCCTCGACAATTTGGTAGGTATAGCCCTCAAAGATCATTTGTATGCCGCTGGGGATACAAGGTTCGGGACAAAGAAGTT
GTACGGGATGGTGCAGTGTAGGCTTGACATATATAATAATAGTTGTCGAGAGTGTGTTGGACACATAGCCGTAAAATTTC
AAGATTGCTGGCATGGTAAACAAGGAGCTAGAGTGTTGGGTAGTGGTTGTAACTTTAGGTATGAGCTTTACCCTTTTGTT
GGTAGTAACAAGCGCGGTCGTAATTTAAACTAA