Details for Arabidopsis Locus AT3G21890

Position : Chr3 ( 5`- 7709113 .. 7709733 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21890

Protein [Map View]
MCRGLNNEESRRSDGGGCRSLCTRPSVPVRCELCDGDASVFCEADSAFLCRKCDRWVHGANFLAWRHVRRVLCTSCQKLT
RRCLVGDHDFHVVLPSVTTVGETTVENRSEQDNHEVPFVFL*

DNA
ATGTGTAGAGGCTTGAATAATGAAGAGAGCAGAAGAAGTGACGGAGGAGGTTGCCGGAGTCTCTGCACGAGACCGAGTGT
TCCGGTAAGGTGTGAGCTTTGCGACGGAGACGCCTCCGTGTTCTGTGAAGCGGACTCGGCGTTCCTCTGTAGAAAATGTG
ACCGGTGGGTTCATGGAGCGAATTTTCTAGCTTGGAGACACGTAAGGCGCGTGCTATGCACTTCTTGTCAGAAACTCACG
CGCCGGTGCCTCGTCGGAGATCATGACTTCCACGTTGTTTTACCGTCGGTGACGACGGTCGGAGAAACCACCGTGGAGAA
TAGAAGTGAACAAGATAATCATGAGGTTCCGTTTGTTTTTCTCTGA