Details for Arabidopsis Locus AT3G21840

Position : Chr3 ( 5`- 7695228 .. 7695936 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21840

Protein [Map View]
MSTKKIMLKSSDGKMFEIEEETARQCQTIAHMIEAECTDNVIPVSNVTSEILEMVIEYCNKHHVDAANPCSDEDLKKWDK
EFMEKDQYTIFHLMNAAYDLHIKSLLALAYQTVADMVNDNKWAFE*

DNA
ATGTCGACAAAAAAGATCATGTTGAAGAGCTCAGATGGTAAAATGTTTGAGATTGAAGAAGAGACCGCACGCCAATGCCA
GACCATAGCTCATATGATTGAAGCCGAATGTACGGATAACGTAATCCCGGTTTCAAACGTGACAAGCGAGATTCTTGAGA
TGGTGATCGAGTACTGCAACAAGCACCACGTCGATGCCGCTAATCCTTGCTCCGATGAGGATCTCAAGAAGTGGGACAAG
GAGTTCATGGAAAAAGATCAATACACGATCTTTCATCTCATGAATGCTGCGTATGACCTACACATCAAAAGCCTTCTTGC
TCTAGCTTACCAAACAGTCGCGGATATGGTCAACGACAATAAATGGGCTTTTGAATGA