Details for Arabidopsis Locus AT3G21770

Position : Chr3 ( 5`- 7673276 .. 7674839 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21770

Protein [Map View]
MKTMTQLNIAVVVVVTVLIGMLRSSEAQLQMNFYAKSCPNAEKIISDHIQNHIHNGPSLAAPLIRMHFHDCFVRGCDGSV
LINSTSGNAERDAPPNLTLRGFGFVERIKALLEKVCPKTVSCADIIALTARDAVVATGGPSWSVPTGRRDGRISNKTEAT
NNIPPPTSNFTTLQRLFKNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSQYAANLKANKCKSLNDN
STILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAKSMEKMGRVKVKTGSAGVI
RTRCSVAGS*

DNA
ATGAAGACGATGACGCAATTAAATATTGCGGTTGTGGTTGTAGTGACGGTTCTTATTGGAATGTTGAGATCATCGGAGGC
TCAACTTCAAATGAATTTCTACGCGAAGAGCTGTCCAAACGCAGAGAAAATCATTTCAGATCATATTCAAAATCATATCC
ACAATGGTCCTTCTCTTGCAGCTCCTCTCATCCGAATGCACTTCCATGATTGCTTCGTTAGGGGATGTGACGGATCGGTG
TTGATAAATTCAACATCTGGTAACGCAGAGAGAGATGCACCACCGAATCTAACACTTAGAGGATTCGGTTTCGTGGAAAG
GATTAAGGCTCTTCTTGAAAAAGTGTGTCCTAAGACTGTTTCTTGCGCAGATATCATTGCTTTGACTGCTAGAGACGCAG
TTGTCGCCACCGGAGGTCCTTCATGGAGTGTTCCAACGGGTAGAAGAGACGGTAGGATCTCAAATAAGACGGAGGCTACT
AATAACATTCCACCTCCAACGAGTAATTTCACGACTTTACAACGACTTTTCAAAAACCAAGGCCTTAATCTCAAGGACCT
TGTTCTGCTCTCTGGGGCTCACACGATTGGCGTCTCACATTGTTCTTCCATGAATACGCGTCTCTACAACTTCTCGACTA
CAGTAAAACAAGATCCATCTCTCGATAGCCAGTATGCAGCAAATCTAAAGGCTAACAAATGTAAGAGCCTTAACGACAAT
AGCACCATCCTCGAGATGGATCCCGGTAGTAGCAGAAGCTTCGATCTCAGTTATTATAGGCTTGTCTTGAAGAGGAGAGG
CTTGTTTCAGTCTGATTCTGCATTAACAACGAACTCAGCGACTTTGAAGGTGATCAACGACTTGGTCAACGGTTCTGAAA
AGAAGTTTTTCAAAGCTTTTGCTAAGTCAATGGAGAAGATGGGGAGAGTTAAAGTGAAGACTGGCTCAGCTGGTGTGATC
AGGACACGGTGTTCTGTCGCTGGAAGTTAG