Details for Arabidopsis Locus AT3G21750

Position : Chr3 ( 5`- 7664345 .. 7666195 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21750

Protein [Map View]
MKVELVFIPSPGVGHIRATTALAKLLVASDNRLSVTLIVIPSRVSDDASSSVYTNSEDRLRYILLPARDQTTDLVSYIDS
QKPQVRAVVSKVAGDVSTRSDSRLAGIVVDMFCTSMIDIADEFNLSAYIFYTSNASYLGLQFHVQSLYDEKELDVSEFKD
TEMKFDVPTLTQPFPAKCLPSVMLNKKWFPYVLGRARSFRATKGILVNSVADMEPQALSFFSGGNGNTNIPPVYAVGPIM
DLESSGDEEKRKEILHWLKEQPTKSVVFLCFGSMGGFSEEQAREIAVALERSGHRFLWSLRRASPVGNKSNPPPGEFTNL
EEILPKGFLDRTVEIGKIISWAPQVDVLNSPAIGAFVTHCGWNSILESLWFGVPMAAWPIYAEQQFNAFHMVDELGLAAE
VKKEYRRDFLVEEPEIVTADEIERGIKCAMEQDSKMRKRVMEMKDKLHVALVDGGSSNCALKKFVQDVVDNVP*

DNA
ATGAAAGTAGAACTTGTGTTCATACCATCGCCGGGCGTTGGCCATATCCGAGCAACAACGGCGTTAGCAAAGCTTCTCGT
TGCCAGCGACAACCGCCTCTCCGTCACTCTCATCGTCATTCCTTCACGAGTCTCCGACGACGCTTCTTCCTCCGTCTACA
CGAACTCCGAAGACCGTCTCCGCTACATCCTCCTCCCCGCCCGAGATCAAACTACTGATCTCGTATCTTACATCGACAGC
CAGAAACCACAAGTAAGAGCCGTCGTGTCCAAGGTCGCTGGAGATGTTTCAACACGTTCAGACTCACGGCTAGCTGGGAT
TGTCGTAGACATGTTCTGCACGTCCATGATAGACATCGCCGATGAGTTTAACCTCTCGGCTTATATCTTCTACACGTCCA
ACGCTTCTTATCTCGGGCTACAGTTCCACGTTCAATCTCTTTACGACGAGAAAGAACTCGACGTAAGTGAGTTCAAAGAT
ACGGAGATGAAGTTTGACGTTCCAACTCTGACTCAGCCTTTTCCGGCAAAATGTTTGCCTTCAGTGATGCTAAACAAGAA
ATGGTTTCCTTACGTTTTGGGTCGAGCTAGAAGTTTTAGAGCAACGAAGGGTATTTTGGTAAATTCGGTGGCTGACATGG
AACCTCAGGCGTTGAGTTTCTTTTCCGGTGGAAATGGGAATACAAATATCCCTCCGGTGTACGCGGTTGGGCCCATTATG
GACTTAGAATCTAGCGGCGATGAAGAGAAGAGAAAGGAGATTTTACATTGGCTAAAAGAGCAACCGACGAAATCTGTAGT
GTTTCTCTGTTTTGGGAGCATGGGAGGTTTCAGTGAGGAACAAGCAAGAGAAATAGCTGTGGCGCTCGAGCGAAGCGGAC
ACAGGTTTCTCTGGTCGCTTCGCCGCGCTTCTCCTGTTGGAAACAAGTCTAATCCTCCTCCCGGAGAATTCACGAACTTA
GAGGAGATTCTTCCAAAAGGGTTTTTAGATCGGACGGTGGAGATAGGGAAGATCATAAGCTGGGCACCACAAGTAGATGT
GTTGAATAGTCCTGCTATAGGAGCGTTCGTGACACATTGTGGATGGAACTCAATTCTCGAGAGTCTTTGGTTCGGTGTTC
CGATGGCGGCGTGGCCTATCTATGCTGAGCAACAGTTTAACGCGTTTCATATGGTGGATGAGCTTGGTTTAGCGGCGGAG
GTAAAGAAGGAGTACCGTAGAGATTTTCTGGTGGAGGAGCCGGAGATTGTGACGGCTGATGAGATAGAGAGAGGGATCAA
GTGTGCGATGGAGCAGGATAGCAAGATGAGGAAGAGGGTGATGGAGATGAAGGATAAGCTCCACGTGGCGTTGGTGGACG
GTGGATCTTCGAACTGTGCTCTAAAGAAGTTTGTTCAAGACGTGGTCGATAATGTTCCATAA