Details for Arabidopsis Locus AT3G21740

Position : Chr3 ( 5`- 7662361 .. 7664010 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21740

Protein [Map View]
MSNWRHKLWRKLSSFQRASYSTTSSRNNKLKLDDLRKLRPMILKRIENRAKDYPVKEIVPVAEEILIARKNLISNIAALL
KVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLHNISQGVIRHQERFDYDRVPAIL
ELCCQAGAIHPEEILQYSEIHDNPQISEEDIRSLPAGDLKYVGANALMAWEKVRAGVKKLLLVYPSKVCKRCKEVHVGPS
GHKARLCGVFKYESWRGTHYWEKAGVNDLVPEKMVWHRRPQDPVVLVDEGRSYYGHAPAIVSLCSHTGAIVPVKYACKMK
PQGLSFSFTNPVPNLET*

DNA
ATGTCGAATTGGAGACATAAACTATGGAGAAAATTGAGCTCATTTCAGAGAGCTAGTTACTCAACTACATCTTCAAGAAA
CAACAAATTAAAGCTTGATGACCTTAGAAAACTCCGGCCAATGATTCTAAAGAGAATCGAAAATCGAGCTAAAGATTACC
CGGTTAAAGAGATTGTTCCTGTAGCTGAAGAAATCCTTATAGCTAGAAAGAATCTAATCAGTAACATCGCCGCTCTTCTT
AAGGTGTTTCCTGTCTTGACATGCAAATTCTGTTCAGAAGTGTTTGTTGGCAAAGAAGGACATTTGATTGAGACATGTCG
TAGTTATATACGGCGTGGTAACAATAGGCTACACGAATGGGTTCCAGGTTCCATAAACGATATACTTGTGCCAGTTGAAT
CCTATCACTTACACAACATCTCTCAAGGTGTTATCAGACACCAAGAGAGGTTTGATTATGATCGTGTTCCCGCAATCTTG
GAACTATGTTGTCAAGCAGGAGCCATCCATCCTGAAGAAATCCTTCAATATTCGGAAATTCACGATAACCCGCAAATCTC
TGAGGAAGATATCAGGAGTTTACCCGCTGGAGATCTCAAATATGTTGGGGCAAACGCTCTTATGGCGTGGGAGAAAGTGA
GAGCTGGTGTGAAGAAACTATTGCTTGTTTATCCTTCAAAAGTTTGCAAACGATGTAAGGAGGTTCATGTGGGTCCGAGT
GGTCATAAAGCTCGGTTATGTGGTGTGTTCAAATATGAGAGCTGGCGCGGCACTCATTACTGGGAAAAAGCCGGTGTGAA
TGATTTGGTACCCGAGAAAATGGTGTGGCACCGGAGGCCTCAGGACCCAGTGGTTCTTGTTGACGAAGGGCGGAGTTATT
ATGGGCATGCCCCTGCTATTGTGAGCCTTTGTAGCCATACCGGTGCCATTGTTCCTGTAAAATACGCTTGCAAGATGAAG
CCCCAAGGTTTATCTTTTTCTTTCACTAATCCAGTTCCAAATCTCGAAACGTAG