Details for Arabidopsis Locus AT3G21730

Position : Chr3 ( 5`- 7659556 .. 7661232 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21730

Protein [Map View]
MHSSLKTMAPAKLERLCVLSFFLFCATVFGTESLESLPEDKLILRGLKFYGFHGVLPEERELGGLFIVDINLWLSLKKAI
ESDNLADTVSFADTFRLVKKIVEGPPRNLYETVADDIASEMLETFPKINVIRVKFGKPNPSLVNSTVDFLGAELFRKRNH
*

DNA
ATGCATAGCTCACTGAAAACAATGGCTCCAGCAAAGTTGGAACGACTATGTGTTCTCTCATTCTTTCTTTTTTGTGCAAC
AGTTTTTGGAACAGAATCATTGGAGTCATTGCCTGAGGATAAACTGATACTGAGAGGGTTGAAATTTTATGGTTTCCATG
GAGTGCTTCCAGAAGAGAGGGAATTGGGTGGTCTGTTTATCGTTGACATTAATTTGTGGTTGAGTCTGAAAAAGGCCATT
GAATCAGACAACTTAGCAGATACAGTTAGCTTTGCTGATACTTTTAGGCTAGTGAAGAAAATTGTTGAAGGGCCACCAAG
AAACCTTTACGAGACGGTTGCGGATGACATAGCGTCTGAAATGCTTGAAACGTTTCCTAAGATAAATGTTATTCGAGTGA
AGTTCGGAAAGCCAAATCCCTCACTAGTTAATAGCACCGTTGATTTCTTAGGGGCCGAGCTTTTCAGGAAGCGAAATCAC
TAA