Details for Arabidopsis Locus AT3G21720

Position : Chr3 ( 5`- 7652487 .. 7656011 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21720

Protein [Map View]
MAASFSVPSMIMEEEGRFEAEVAEVQTWWSSERFKLTRRPYTARDVVALRGHLKQGYASNEMAKKLWRTLKSHQANGTAS
RTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGPDLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREER
TKTPFVDYLKPIIADGDTGFGGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVAVSEHINRLVAARLQFDV
MGTETVLVARTDAVAATLIQSNIDARDHQFILGATNPSLRGKSLSSLLAEGMTVGKNGPALQSIEDQWLGSAGLMTFSEA
VVQAIKRMNLNENEKNQRLSEWLTHARYENCLSNEQGRVLAAKLGVTDLFWDWDLPRTREGFYRFQGSVAAAVVRGWAFA
QIADIIWMETASPDLNECTQFAEGIKSKTPEVMLAYNLSPSFNWDASGMTDQQMVEFIPRIARLGYCWQFITLAGFHADA
LVVDTFAKDYARRGMLAYVERIQREERTHGVDTLAHQKWSGANYYDRYLKTVQGGISSTAAMGKGVTEEQFKESWTRPGA
DGMGEGTSLVVAKSRM*

DNA
ATGGCTGCATCTTTCTCTGTCCCCTCTATGATAATGGAAGAAGAAGGGAGATTCGAAGCGGAGGTTGCGGAAGTGCAGAC
TTGGTGGAGCTCAGAGAGGTTCAAGCTAACAAGGCGCCCTTACACTGCCCGTGACGTGGTGGCTCTACGTGGCCATCTCA
AGCAAGGCTATGCTTCGAACGAGATGGCTAAGAAGCTGTGGAGAACGCTCAAAAGCCATCAAGCCAACGGTACGGCCTCT
CGCACCTTCGGAGCGTTGGACCCTGTTCAGGTGACCATGATGGCTAAACATTTGGACACCATCTATGTCTCTGGTTGGCA
GTGCTCGTCCACTCACACATCCACTAATGAGCCTGGTCCTGATCTTGCTGATTATCCGTACGACACCGTTCCTAACAAGG
TTGAACACCTCTTCTTCGCTCAGCAGTACCATGACAGAAAGCAGAGGGAGGCAAGAATGAGCATGAGCAGAGAAGAGAGG
ACAAAAACTCCGTTCGTGGACTACCTAAAGCCCATCATCGCCGACGGAGACACCGGCTTTGGCGGCACCACCGCCACCGT
CAAACTCTGCAAGCTTTTCGTTGAAAGAGGCGCCGCTGGGGTCCACATCGAGGACCAGTCCTCCGTCACCAAGAAGTGTG
GCCACATGGCCGGAAAGGTCCTCGTGGCAGTCAGCGAACACATCAACCGCCTTGTCGCGGCTCGGCTCCAGTTCGACGTG
ATGGGTACAGAGACCGTCCTTGTTGCTAGAACAGATGCGGTCGCAGCTACTCTGATCCAGTCGAACATTGACGCGAGGGA
CCACCAGTTCATCCTCGGTGCCACTAACCCGAGCCTTAGAGGCAAGAGTTTGTCCTCGCTTCTGGCTGAGGGAATGACTG
TAGGCAAGAATGGTCCGGCGTTGCAATCCATTGAAGATCAGTGGCTTGGCTCGGCCGGTCTTATGACTTTCTCGGAAGCT
GTCGTGCAGGCCATCAAGCGCATGAACCTCAACGAGAACGAGAAGAATCAGAGACTGAGCGAGTGGTTAACCCATGCAAG
GTATGAGAACTGCCTGTCAAATGAGCAAGGCCGAGTGTTAGCAGCAAAACTTGGTGTGACAGATCTTTTCTGGGACTGGG
ACTTGCCGAGAACCAGAGAAGGATTCTACCGGTTCCAAGGCTCGGTCGCAGCGGCCGTGGTCCGTGGCTGGGCCTTTGCA
CAGATCGCAGACATCATCTGGATGGAAACGGCAAGCCCTGATCTCAATGAATGCACCCAATTCGCCGAAGGTATCAAGTC
CAAGACACCGGAGGTCATGCTCGCCTACAATCTCTCGCCGTCCTTCAACTGGGACGCTTCCGGTATGACGGATCAGCAGA
TGGTTGAGTTCATTCCGCGGATTGCTAGGCTCGGATATTGTTGGCAGTTCATAACGCTTGCGGGTTTCCATGCGGATGCT
CTTGTGGTTGATACATTTGCAAAGGATTACGCTAGGCGCGGGATGTTGGCTTATGTGGAGAGGATACAAAGAGAAGAGAG
GACCCATGGGGTTGACACTTTGGCTCACCAGAAATGGTCCGGTGCTAATTACTATGATCGTTATCTTAAGACCGTCCAAG
GTGGAATCTCCTCCACTGCAGCCATGGGAAAAGGTGTCACTGAAGAACAGTTCAAGGAGAGTTGGACAAGGCCGGGAGCT
GATGGAATGGGTGAAGGGACTAGCCTTGTGGTCGCCAAGTCAAGAATGTAA