Details for Arabidopsis Locus AT3G21700

Position : Chr3 ( 5`- 7644350 .. 7646383 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21700

Protein [Map View]
MAQSCLKIVRINNLRNRVNRRILILRRFTRLLWSRIVACTPGKSRRYLLLSRALPSPTVSRPSPSPIPAVDVVVGGGGGG
GEFVRRSSVVYDNDNSHRRSDSDLVSLKISLLGDPEIGKTSFLAKYVGEEKEVEMRELEKGINCTDKTLYMGGARISYSI
WELEGAERSRDQIPVACKDSVAILFMFDLTSRCTLNSVISWYQQARKSNQTAIPVMVGTKFDEFIQLPIDLQWTIASQAR
TYAKALNATLFFSSASYNINVNKIFKFVTAKLFDLPWTVERNLTIGEPIIDF*

DNA
ATGGCTCAATCGTGTCTTAAAATTGTTCGAATCAACAATCTAAGGAACAGAGTGAATCGTCGGATTTTGATTCTCCGACG
ATTCACACGGTTGTTATGGAGTAGAATCGTTGCTTGTACTCCTGGCAAATCTCGGAGATATCTCTTGCTTTCTCGCGCTC
TTCCGTCTCCGACTGTTTCTCGTCCTTCTCCTTCTCCGATCCCCGCCGTCGATGTCGTCGTCGGTGGTGGTGGTGGTGGT
GGTGAGTTTGTTCGTCGTTCGTCGGTTGTTTACGATAATGATAACAGTCATCGGAGATCGGATTCTGATTTGGTTTCTTT
GAAGATTAGTCTCTTAGGAGATCCAGAAATCGGAAAAACTAGCTTCCTGGCGAAATATGTTGGAGAAGAGAAAGAAGTAG
AAATGAGAGAATTGGAGAAAGGTATAAATTGTACGGACAAGACGTTATACATGGGAGGTGCTCGCATTTCATATAGTATC
TGGGAATTAGAAGGAGCTGAGAGATCACGAGATCAAATCCCTGTGGCTTGCAAGGACTCTGTTGCCATTCTCTTTATGTT
TGATTTAACCAGTCGTTGCACGCTTAATAGTGTCATTAGCTGGTATCAACAAGCTAGGAAGTCTAATCAGACGGCGATAC
CAGTTATGGTAGGAACCAAGTTTGATGAGTTTATTCAGCTTCCTATTGATCTGCAATGGACAATTGCTAGCCAGGCGAGA
ACATATGCGAAGGCTTTAAACGCGACGCTCTTCTTCTCGAGTGCTTCATACAACATAAACGTGAATAAGATCTTTAAGTT
TGTGACGGCGAAGCTCTTCGACTTACCATGGACGGTGGAGCGCAATCTCACAATCGGAGAACCAATCATCGACTTCTAG