Details for Arabidopsis Locus AT3G21690

Position : Chr3 ( 5`- 7638663 .. 7642205 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21690

Protein [Map View]
MDSSPNDGVHQPLLHPQPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLLFNLAAPAVIVYMINYLMSMSTQIF
SGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILL
FLGESPAIASAASLFVYGLIPQIFAYAANFPIQKFLQSQSIVAPSAYISTATLFVHLLLSWLAVYKLGMGLLGASLVLSL
SWWIIVVAQFVYIVTSERCRETWRGFSVQAFSGLWSFFKLSAASAVMLCLETWYFQILVLLAGLLENPELALDSLSICMT
ISGWVFMISVGFNAAISVRVSNELGAGNPKSAAFSVIIVNIYSLITCVILAIVILACRDVLSYAFTEGKEVSDAVSDLCP
LLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLGALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRT
DWTKEVEEASKRLDKWSNKKQEVVPE*

DNA
ATGGACTCGTCTCCAAACGACGGCGTACACCAACCGCTTCTCCATCCTCAACCATCTCCATCTCCGCCGGAGTCAACCAA
CGGCGAGCTAGAAACTGTCCTCTCCGACGTAGAAACTCCTCTGTTTCTCCGCCTACGTAAAGCCACCATAATCGAATCAA
AGCTTCTCTTTAACCTCGCTGCACCAGCCGTCATCGTCTACATGATTAACTACCTCATGTCCATGTCTACTCAAATCTTC
TCCGGCCATCTCGGTAACCTCGAACTCGCCGCCGCTTCTCTTGGTAACACCGGTATTCAAGTCTTCGCTTACGGTCTCAT
GCTAGGCATGGGGAGTGCAGTGGAGACGTTATGTGGTCAAGCGTACGGTGGTAGAAAATACGAGATGCTTGGAGTTTATC
TCCAAAGATCAACCGTATTACTAACACTCACCGGCCTCCTCCTTACTTTAATCTACGTTTTCTCCGAACCAATCCTTCTC
TTCCTCGGTGAATCTCCCGCAATCGCTTCGGCCGCATCGCTCTTCGTCTACGGTCTTATCCCTCAAATCTTTGCCTACGC
AGCGAACTTTCCAATACAAAAATTTCTCCAATCACAAAGCATAGTAGCTCCAAGTGCTTATATCTCAACGGCTACGCTCT
TTGTTCACCTTCTTTTAAGTTGGCTCGCGGTTTACAAGCTTGGTATGGGACTTCTTGGTGCGTCGCTTGTGCTTAGCTTG
TCGTGGTGGATTATAGTCGTGGCTCAGTTTGTTTATATTGTGACGAGTGAGAGGTGTCGTGAGACGTGGAGAGGTTTTAG
TGTTCAAGCTTTCTCGGGTTTGTGGAGTTTCTTTAAACTCTCCGCCGCTTCTGCCGTGATGCTTTGCCTTGAGACTTGGT
ATTTTCAGATTCTCGTTCTTCTTGCCGGACTTCTCGAGAATCCTGAACTTGCTCTTGATTCACTCTCTATTTGCATGACG
ATTTCAGGGTGGGTGTTCATGATATCTGTTGGATTCAATGCAGCGATAAGTGTAAGAGTGAGCAATGAACTTGGAGCTGG
GAACCCTAAATCAGCAGCTTTTTCTGTGATCATCGTTAACATTTATTCGTTAATCACTTGTGTGATCCTAGCCATTGTTA
TTTTAGCGTGCCGCGATGTTTTAAGCTATGCTTTCACTGAGGGTAAAGAAGTCTCGGACGCTGTTTCTGATCTCTGTCCG
CTTCTTGCCGTAACACTTGTCCTTAACGGAATCCAACCTGTCCTCTCTGGTGTGGCGGTTGGATGCGGTTGGCAAACGTT
TGTGGCGAAGGTTAACGTTGGATGTTACTACATTATTGGAATTCCTCTTGGGGCTCTCTTTGGGTTTTACTTTAACTTCG
GTGCCAAGGGTATATGGACGGGGATGATCGGTGGTACGGTTATACAAACGTTTATTTTGGCGTGGGTCACGTTTAGAACA
GATTGGACAAAAGAAGTGGAAGAAGCTTCCAAAAGGTTGGACAAATGGAGCAACAAGAAACAAGAAGTTGTTCCTGAATG
A