Details for Arabidopsis Locus AT3G21610

Position : Chr3 ( 5`- 7609143 .. 7610717 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21610

Protein [Map View]
MDEVMTAADVGSLGGGNRALYGSPPSHNLFPHNLPIFSAFLAFALAQFLKVFTNWYKEKRWDSKRMISSGGMPSSHSATV
TALAVAIGFEEGAGAPAFAIAVVLACVVMYDASGVRLHAGRQAELLNQIVCEFPPEHPLSTVRPLRELLGHTPIQVAAGG
ILGCVVAYLMRSSS*

DNA
ATGGACGAGGTGATGACAGCGGCGGACGTTGGTTCGTTAGGTGGCGGCAATAGGGCGTTGTACGGATCTCCTCCGTCGCA
TAATCTGTTTCCTCACAATCTCCCAATCTTCTCCGCTTTTCTTGCCTTCGCTCTTGCTCAGTTCCTCAAAGTCTTCACTA
ATTGGTACAAAGAAAAGAGGTGGGACTCTAAACGTATGATTAGTTCTGGTGGAATGCCTTCTTCTCATTCTGCTACTGTC
ACTGCCTTAGCTGTTGCCATTGGCTTTGAAGAAGGAGCTGGAGCACCAGCTTTTGCTATTGCAGTTGTCTTGGCTTGCGT
TGTTATGTATGATGCCTCTGGTGTCAGGCTTCATGCTGGTCGTCAAGCCGAGCTGCTGAATCAAATTGTTTGTGAGTTTC
CTCCGGAGCATCCATTATCAACAGTTAGACCATTGCGTGAACTGCTTGGCCACACTCCTATCCAGGTTGCAGCAGGTGGG
ATTTTAGGATGCGTGGTAGCTTACTTAATGAGGAGCTCAAGCTAG