Details for Arabidopsis Locus AT3G21560

Position : Chr3 ( 5`- 7595806 .. 7597577 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21560

Protein [Map View]
MELESSPPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLITFVTTESWGKKMRISNKIQDRVLKPVGKGYLRYDFFDDG
LPEDDEASRTNLTILRPHLELVGKREIKNLVKRYKEVTKQPVTCLINNPFVSWVCDVAEDLQIPCAVLWVQSCACLAAYY
YYHHNLVDFPTKTEPEIDVQISGMPLLKHDEIPSFIHPSSPHSALREVIIDQIKRLHKTFSIFIDTFNSLEKDIIDHMST
LSLPGVIRPLGPLYKMAKTVAYDVVKVNISEPTDPCMEWLDSQPVSSVVYISFGTVAYLKQEQIDEIAYGVLNADVTFLW
VIRQQELGFNKEKHVLPEEVKGKGKIVEWCSQEKVLSHPSVACFVTHCGWNSTMEAVSSGVPTVCFPQWGDQVTDAVYMI
DVWKTGVRLSRGEAEERLVPREEVAERLREVTKGEKAIELKKNALKWKEEAEAAVARGGSSDRNLEKFVEKLGAKPVGKV
QNGSHNHVLAGSIKSF*

DNA
ATGGAGCTAGAATCTTCTCCTCCTCTACCTCCTCATGTGATGCTCGTATCTTTTCCAGGGCAAGGCCACGTTAATCCACT
TCTTCGTCTTGGTAAGCTCTTAGCTTCAAAGGGTTTGCTCATAACCTTCGTCACCACTGAGTCATGGGGCAAAAAGATGC
GAATCTCCAACAAAATCCAAGACCGTGTCCTCAAACCGGTTGGTAAAGGCTATCTCCGGTATGATTTCTTCGACGACGGG
CTTCCTGAAGACGACGAAGCTAGCAGAACCAACTTAACCATCCTCCGACCACATCTAGAGCTGGTCGGCAAAAGAGAGAT
CAAGAACCTTGTGAAACGTTACAAGGAAGTAACGAAACAGCCCGTGACATGTCTTATCAACAACCCTTTCGTCTCTTGGG
TCTGTGACGTGGCAGAAGATCTTCAAATCCCTTGTGCTGTTCTTTGGGTTCAATCTTGTGCCTGCTTAGCTGCTTATTAC
TATTACCACCACAACCTAGTTGACTTCCCGACCAAAACAGAACCCGAGATCGATGTCCAAATCTCTGGCATGCCTCTCTT
GAAACATGACGAGATCCCTTCTTTCATTCACCCTTCAAGTCCTCACTCCGCTTTGCGAGAAGTGATCATAGATCAGATTA
AACGGCTTCACAAGACTTTCTCCATTTTCATCGACACTTTCAACTCATTGGAGAAAGACATCATTGACCACATGTCGACG
CTCTCTCTCCCCGGTGTTATCAGACCGCTAGGACCACTCTACAAAATGGCTAAAACCGTAGCTTATGATGTCGTTAAAGT
AAACATCTCTGAGCCAACGGATCCTTGCATGGAGTGGTTAGACTCGCAGCCAGTTTCCTCCGTTGTTTACATCTCATTCG
GGACCGTTGCTTACTTGAAACAAGAACAAATAGACGAGATCGCTTACGGTGTGTTAAACGCCGACGTTACGTTCTTGTGG
GTGATTAGACAACAAGAGTTAGGTTTCAACAAAGAGAAACATGTTTTGCCGGAAGAAGTTAAAGGGAAAGGGAAGATCGT
TGAATGGTGTTCACAAGAGAAAGTATTATCTCATCCTTCAGTGGCATGTTTCGTGACTCACTGTGGATGGAACTCAACGA
TGGAAGCTGTGTCTTCCGGAGTCCCGACGGTTTGTTTTCCTCAATGGGGAGATCAAGTCACGGACGCCGTTTACATGATC
GATGTTTGGAAGACGGGAGTGAGGCTAAGCCGTGGAGAGGCGGAGGAGAGGTTAGTGCCGAGGGAGGAAGTTGCGGAGAG
GTTGAGAGAGGTTACTAAAGGAGAGAAAGCGATCGAGTTGAAAAAGAATGCTTTGAAGTGGAAGGAAGAGGCGGAGGCGG
CGGTTGCTCGCGGTGGTTCGTCGGATAGGAATCTTGAAAAGTTTGTGGAGAAGTTGGGTGCCAAACCTGTGGGGAAAGTA
CAAAACGGGAGTCATAATCATGTCTTGGCTGGATCAATCAAAAGCTTTTAA