Details for Arabidopsis Locus AT3G21510

Position : Chr3 ( 5`- 7578175 .. 7579599 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21510

Protein [Map View]
MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQ
LKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF*

DNA
ATGGATTTGGTTCAGAAGCAGAAGAGTTTGCAAGATTACACCAAATCACTCTTCTTAGAAGGGATTTTGGACAGCCAGTT
CTTGCAGCTGCAACAACTACAAGATGAAAGCAATCCAGATTTTGTTTCACAAGTTGTCACACTCTTCTTCCAAGACTCTG
ATAGGATTCTCAATGATCTCTCACTTTCCCTAGATCAACAAGTTGTAGACTTTAAAAAAGTTGATCCCCATGTTCATCAA
CTCAAAGGTAGCAGCTCCAGTATAGGAGCACAGAGAGTTAAGAATGCTTGTGTTGTCTTCCGCAGCTTCTGCGAGCAGCA
AAATGTCGAAGCATGTCATAGATGTTTGCAACAAGTGAAGCAAGAGTATTATCTTGTGAAAAACAGATTAGAGACTCTGT
TCAAGCTGGAGCAACAGATTGTAGCTTCTGGTGGAATGATCCCGGCCGTCGAACTCGGATTTTGA