Details for Arabidopsis Locus AT3G21500

Position : Chr3 ( 5`- 7573634 .. 7576623 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21500

Protein [Map View]
MSYQTQINKFSQMALSVFAFPSYINRNPSLKYLKPSSMSSTKYSKVRATTFSEKGEYYSNRPPTPLLDTINHPMHMKNLS
IKELKVLSDELRSDVIFNVSKTGGHLGSNLGVVELTVALHYIFNTPHDKILWDVGHQSYPHKILTGRRGKMKTIRQTNGL
SGYTKRRESEHDSFGTGHSSTTLSAGLGMAVGRDLKGMNNSVVSVIGDGAMTAGQAYEAMNNAGYLHSNMIVILNDNKQV
SLPTANLDGPTQPVGALSCALSRLQSNCGMIRETSSTLFEELGFHYVGPVDGHNIDDLVSILETLKSTKTIGPVLIHVVT
EKGRGYPYAERADDKYHGVLKFDPETGKQFKNISKTQSYTSCFVEALIAEAEADKDIVAIHAAMGGGTMLNLFESRFPTR
CFDVGIAEQHAVTFAAGLACEGLKPFCTIYSSFMQRAYDQVVHDVDLQKLPVRFAIDRAGLMGADGPTHCGAFDVTFMAC
LPNMIVMAPSDEAELFNMVATAAAIDDRPSCFRYHRGNGIGVSLPPGNKGVPLQIGRGRILRDGERVALLGYGSAVQRCL
EAASMLSERGLKITVADARFCKPLDVALIRSLAKSHEVLITVEEGSIGGFGSHVVQFLALDGLLDGKLKVYRTWITNGST
S*

DNA
ATGTCATATCAAACACAGATTAACAAATTCTCTCAAATGGCTCTCTCCGTATTTGCCTTTCCTTCTTACATAAATAGGAA
TCCTTCACTAAAATATCTTAAACCTTCTTCTATGTCTTCTACAAAATATTCAAAAGTAAGAGCAACAACATTTTCAGAGA
AAGGTGAATATTATTCAAACAGACCACCAACTCCTTTATTGGACACAATCAACCATCCAATGCACATGAAAAATCTCTCC
ATCAAAGAACTCAAAGTTCTTTCGGACGAGTTGAGATCTGATGTTATTTTTAATGTTTCGAAAACTGGAGGACACTTGGG
TTCGAATCTTGGTGTTGTTGAGCTCACCGTGGCCCTTCATTACATCTTCAATACTCCTCATGATAAGATCCTTTGGGATG
TTGGTCATCAGTCTTATCCTCACAAGATTCTAACGGGAAGAAGAGGAAAGATGAAGACAATAAGGCAGACCAATGGCCTC
TCCGGCTACACCAAGCGAAGAGAGAGTGAGCATGACTCTTTTGGCACCGGGCACAGTTCGACCACACTATCTGCAGGCTT
AGGGATGGCTGTAGGGAGGGATTTGAAGGGGATGAACAACAGCGTGGTTTCGGTTATAGGCGATGGTGCTATGACAGCTG
GACAAGCTTATGAAGCAATGAACAATGCTGGCTACTTACACTCCAACATGATTGTGATTCTCAACGACAACAAACAAGTA
TCTTTGCCTACTGCTAACTTGGATGGACCAACTCAACCTGTTGGAGCTCTGAGCTGTGCTCTTAGTAGGCTGCAATCTAA
TTGTGGAATGATTAGAGAGACTAGTTCAACACTGTTTGAAGAACTTGGTTTTCACTATGTTGGTCCAGTTGATGGACACA
ACATAGATGATCTGGTCTCCATTCTTGAAACATTAAAGAGCACCAAAACCATAGGACCGGTTCTTATCCATGTCGTGACT
GAGAAAGGTCGTGGATATCCTTACGCAGAGAGAGCTGATGACAAGTATCATGGAGTTTTAAAATTTGATCCAGAAACAGG
TAAACAGTTCAAAAATATTTCCAAGACTCAGTCTTACACTTCCTGTTTTGTGGAGGCCTTGATTGCAGAAGCAGAGGCAG
ACAAAGATATTGTTGCCATTCATGCAGCCATGGGAGGTGGAACCATGTTGAATCTCTTCGAAAGCCGCTTTCCTACAAGG
TGTTTCGATGTCGGCATAGCAGAACAACATGCAGTTACCTTCGCTGCTGGTCTTGCTTGCGAAGGACTTAAGCCCTTTTG
TACAATCTACTCATCTTTCATGCAACGGGCATATGATCAAGTTGTACATGATGTTGATCTACAGAAACTGCCTGTGAGAT
TTGCAATAGATAGAGCAGGACTTATGGGAGCAGATGGTCCAACACATTGTGGAGCATTTGATGTGACGTTTATGGCATGT
CTACCAAACATGATAGTAATGGCTCCATCTGATGAAGCAGAGCTTTTTAACATGGTTGCAACCGCTGCAGCTATTGATGA
CCGTCCTTCTTGCTTTCGATATCATAGAGGAAATGGTATTGGTGTTTCACTTCCTCCTGGTAACAAAGGTGTCCCTCTTC
AGATTGGGAGAGGTAGGATACTAAGGGACGGCGAGAGGGTTGCGCTTTTGGGCTATGGATCAGCGGTGCAAAGATGTTTA
GAGGCTGCATCTATGCTAAGCGAACGCGGATTAAAGATAACAGTAGCGGATGCAAGATTCTGTAAGCCGTTAGATGTTGC
TCTCATTCGTAGCTTAGCTAAATCACACGAGGTTTTGATCACGGTTGAAGAAGGTTCCATTGGAGGATTTGGATCGCATG
TGGTACAATTTCTTGCACTTGATGGCCTTCTTGATGGAAAGCTCAAGGTATATCGAACATGGATCACCAATGGATCAACT
AGCTGA