Details for Arabidopsis Locus AT3G21480

Position : Chr3 ( 5`- 7567730 .. 7572161 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21480

Protein [Map View]
MAKSNQNFSPYEETQPIDSNPPSSSDSGEDKDSLLGDCDTQPVDDNALINDQYMETQVMDTECDNEEFLLCNETQAVDLG
FETGEEVLVEGKQLLEASDGLATQVLDLCDDEVVVDSDDDVTDVLEGNSDLSDSDDSGSKAETVLSSEENRQDANEKVKS
AVVFDAWSNEHGVSGKKVARFASVRSAAFRASAVAARVANQKSANTDCSTLINCHSSGKGTTHNSGLENSVGEVGNQQSL
TSLFVEEKKDLRTGKKTARKLFVEDFPEEKFHSTDCNVDLGNLSYIGSQEPGEESQASALNLVDKLISECRLEFDFEVQA
DYGRKTEDKSKFVQIFKGPQELAKKVSYKSGAVGNNIFDWDDNREDEGGGDIYRRRKDEFFGVASKRREFSSLPREQKRE
LIPVAVDKRWARSDSKLLKHSVTRSRKNIQGAKKNLGKELDEVREAAVLGNDTQVAAEAIDDLCSGDRGKFDGEASCLTG
KKLSPEEERGFSPGGVVTRQSKGTKRIQAMSKDELLKKRMKKASPSPAKACRTNIEGSSNGDQLNKEGPCCWKSRKVQTA
SRETKKNLVDEFDEVSQESNTEMFDRHEEAEAGPDTQMAAEVMNALHSGDGREIDPEPNNLIGKKLLLEGGISRCGVVTR
KSKRIKGIQAVDNDVESLKPKNKKARSILAKSFEKNMDRYSKNDKVDTPDEAVASTTEKRQGELSNKHCMSKLLKQSHRG
EAEVLNYPKRRRSARISQDQVNEAGRSSDPAFDTPAKSKTPSTNVSPICMGDEYHRLSCKDSFTSHTTREFRSLTVPVAE
PISETKSTRKRRDLGSICVLFSQHLDEDVTKHQKKILARFDISEASSMKEATHFIADNFTRTRNMLEAIASGKPVVTTQW
LESIDQVNIYVDEDMYILRDSKKEKEFCFNMGVSLARARQFPLLQGRRVFITPNTKPALNTITTLVKAVHGLPVERLGRS
SLSEDKVPENLLVLSCEEDRAICIPFLERGAEVYSSELLLNGIVTQRLEYERYRLFTDHVRRTRSTIWIKDGKGKFQRRS
G*

DNA
ATGGCTAAATCTAACCAAAACTTTTCTCCGTATGAAGAGACCCAGCCGATTGATTCTAATCCACCTTCTTCTTCTGATTC
TGGCGAGGATAAAGATAGCTTGCTTGGGGATTGTGACACACAACCTGTTGATGACAATGCTTTGATTAATGATCAGTATA
TGGAGACTCAGGTCATGGATACTGAATGTGATAATGAAGAATTTCTTCTTTGTAATGAAACTCAAGCAGTTGATTTGGGA
TTTGAAACCGGAGAAGAAGTACTTGTAGAGGGGAAACAGTTACTTGAAGCTTCTGATGGTTTGGCTACTCAGGTTTTGGA
TCTTTGTGATGATGAAGTTGTTGTGGATAGTGATGATGATGTTACTGATGTGTTGGAGGGCAACAGTGATCTCTCTGATA
GTGATGACTCGGGTAGTAAAGCGGAAACTGTGTTATCTAGTGAAGAGAATAGACAGGATGCTAATGAAAAGGTTAAATCA
GCAGTTGTCTTTGATGCTTGGTCGAACGAACATGGAGTTTCTGGAAAAAAGGTGGCTAGGTTCGCTTCAGTTCGTTCAGC
AGCTTTTCGTGCTTCTGCTGTGGCAGCTCGTGTTGCAAACCAAAAATCTGCCAACACTGACTGTTCTACACTAATCAACT
GTCATTCTTCTGGGAAAGGAACCACACATAATTCTGGTCTAGAAAATAGTGTTGGGGAAGTAGGGAATCAGCAATCTCTT
ACCAGTTTATTTGTTGAAGAGAAAAAGGACTTAAGAACAGGAAAAAAAACAGCGAGGAAGCTTTTCGTAGAGGATTTCCC
TGAAGAAAAATTTCATTCTACTGATTGCAATGTCGATCTGGGGAATTTGAGTTATATTGGCTCTCAAGAACCTGGTGAGG
AATCCCAGGCCAGTGCTCTTAACTTGGTTGATAAGCTCATTAGTGAGTGCCGTCTAGAGTTTGATTTTGAAGTTCAAGCT
GACTATGGAAGGAAAACAGAAGATAAATCAAAATTTGTTCAGATTTTTAAAGGTCCACAAGAATTAGCAAAGAAGGTAAG
TTACAAAAGTGGAGCTGTTGGAAACAATATTTTCGACTGGGATGATAATCGTGAGGATGAAGGAGGGGGTGATATCTATC
GTAGAAGAAAAGATGAATTCTTTGGCGTTGCAAGTAAAAGACGGGAATTTTCTAGCTTGCCTAGAGAACAGAAAAGAGAA
CTGATACCAGTTGCAGTGGATAAAAGATGGGCTCGTTCTGATTCCAAACTGTTGAAGCATAGTGTGACTAGGAGCCGAAA
GAATATCCAGGGTGCTAAAAAGAATCTTGGCAAAGAGTTAGATGAAGTTCGTGAAGCGGCAGTTTTAGGGAATGATACAC
AAGTGGCTGCTGAAGCGATTGATGATCTGTGCTCTGGAGACCGTGGCAAATTTGATGGTGAGGCGAGTTGTCTTACAGGA
AAGAAACTGTCACCAGAAGAAGAGAGAGGATTTTCTCCCGGTGGAGTCGTTACTAGACAATCCAAGGGAACTAAGAGGAT
TCAGGCTATGAGTAAAGATGAATTGTTGAAAAAAAGAATGAAGAAGGCTAGTCCTAGTCCTGCTAAAGCTTGCCGGACGA
ATATCGAAGGATCTTCAAATGGTGACCAGCTTAATAAAGAAGGTCCATGCTGCTGGAAGAGTAGGAAGGTCCAGACTGCT
TCACGAGAAACTAAAAAGAATCTTGTTGACGAGTTTGATGAAGTTTCTCAGGAAAGTAATACAGAAATGTTTGATAGGCA
TGAAGAAGCAGAAGCAGGCCCTGATACACAAATGGCTGCTGAAGTGATGAATGCTCTGCACTCTGGGGACGGCAGGGAAA
TTGATCCTGAGCCAAATAATCTAATAGGTAAGAAATTGTTATTGGAAGGAGGCATTTCTAGGTGTGGAGTCGTTACCAGA
AAGTCCAAGAGGATCAAGGGGATTCAGGCTGTGGACAATGATGTTGAATCATTGAAACCAAAAAACAAGAAGGCTAGATC
AATTCTTGCTAAGTCTTTTGAGAAGAATATGGATAGGTATTCAAAAAATGACAAAGTTGATACGCCAGATGAAGCTGTTG
CGTCAACCACAGAAAAGAGGCAAGGAGAATTATCAAACAAACATTGTATGTCTAAGTTACTTAAGCAATCACATAGAGGT
GAAGCTGAGGTGTTGAATTATCCCAAGCGGAGAAGATCAGCTCGTATTTCACAAGATCAGGTTAATGAGGCTGGGAGGAG
TTCAGATCCCGCGTTTGATACTCCAGCTAAGTCTAAGACGCCGTCAACAAATGTATCGCCTATATGCATGGGTGACGAGT
ATCATAGACTTTCTTGCAAAGATTCATTTACATCACACACTACAAGGGAATTTCGTAGCTTAACCGTACCAGTAGCGGAA
CCTATCTCCGAGACAAAGAGTACTAGAAAGAGAAGAGATTTGGGTAGTATATGTGTCTTGTTCAGCCAGCATCTTGATGA
AGATGTGACCAAGCATCAGAAGAAGATTTTGGCAAGGTTTGATATCTCGGAAGCTTCCTCCATGAAGGAGGCAACACACT
TCATAGCTGATAACTTTACGCGCACAAGGAACATGCTAGAGGCAATCGCTTCAGGCAAGCCAGTGGTCACAACACAATGG
CTTGAAAGCATCGATCAAGTAAACATATACGTTGATGAGGATATGTATATACTCAGAGATTCAAAGAAGGAGAAGGAGTT
CTGTTTCAACATGGGGGTTTCTTTGGCTCGTGCACGCCAGTTTCCGCTACTACAGGGAAGAAGAGTTTTTATCACTCCAA
ATACAAAGCCTGCTTTAAACACAATCACTACTTTGGTTAAAGCAGTTCATGGACTGCCTGTAGAAAGACTCGGAAGATCT
TCCCTAAGCGAAGATAAGGTCCCAGAGAATCTTCTGGTCTTATCATGTGAAGAGGATCGCGCTATCTGTATACCCTTTCT
GGAAAGAGGGGCCGAGGTATATAGCTCGGAGTTACTACTAAATGGGATAGTTACCCAAAGGCTTGAGTATGAGAGGTACC
GTCTCTTCACAGACCATGTGAGAAGAACGCGGTCAACGATATGGATCAAAGACGGGAAAGGTAAGTTCCAACGTCGTAGC
GGGTAA