Details for Arabidopsis Locus AT3G21470

Position : Chr3 ( 5`- 7563503 .. 7565074 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21470

Protein [Map View]
MNLEEHLSLGEFHVSNLIKNHISRGSPIQALVLYGGIRRRGVYFPGWVPLILRACACVVPRVVLGKLLHSESIKFGVCSD
VMVGSSLISMYGKCGCVVSARKVFDEMPERNVATWNAMIGGYMSNGDAVLASGLFEEISVCRNTVTWIEMIKGYGKRIEI
EKARELFERMPFELKNVKAWSVMLGVYVNNRKMEDARKFFEDIPEKNAFVWSLMMSGYFRIGDVHEARAIFYRVFARDLV
IWNTLIAGYAQNGYSDDAIDAFFNMQGEGYEPDAVTVSSILSACAQSGRLDVGREVHSLINHRGIELNQFVSNALIDMYA
KCGDLENATSVFESISVRSVACCNSMISCLAIHGKGKEALEMFSTMESLDLKPDEITFIAVLTACVHGGFLMEGLKIFSE
MKTQDVKPNVKHFGCLIHLLGRSGKLKEAYRLVKEMHVKPNDTVLGALLGACKVHMDTEMAEQVMKIIETAGSITNSYSE
NHLASISNLYAHTERWQTAEALRVEMEKRGLEKSPGLSSLVLT*

DNA
ATGAATTTGGAGGAACATTTATCGTTAGGTGAGTTTCATGTGTCGAATCTTATAAAGAATCATATATCTAGAGGATCACC
AATACAAGCTCTGGTTTTGTACGGAGGAATCCGCCGCAGAGGAGTGTATTTTCCGGGATGGGTTCCTTTGATTTTAAGGG
CATGTGCTTGCGTTGTTCCACGTGTTGTTCTTGGGAAGCTGTTGCATTCTGAATCAATCAAGTTCGGTGTTTGTTCTGAT
GTTATGGTGGGAAGCTCTCTGATCAGTATGTATGGGAAATGTGGATGTGTAGTTTCTGCACGTAAGGTGTTTGACGAAAT
GCCTGAGAGAAACGTGGCTACTTGGAACGCTATGATTGGTGGGTATATGAGCAATGGTGATGCAGTTTTGGCTAGTGGAT
TGTTTGAAGAGATATCGGTTTGTAGAAATACGGTGACTTGGATCGAGATGATTAAAGGGTATGGGAAGAGAATAGAGATT
GAGAAAGCTAGAGAATTGTTTGAGAGAATGCCTTTCGAGTTAAAGAATGTGAAGGCTTGGTCTGTGATGCTTGGAGTTTA
CGTTAATAATCGAAAAATGGAGGATGCAAGGAAGTTTTTCGAGGATATACCGGAGAAGAACGCCTTTGTATGGTCATTGA
TGATGTCTGGGTATTTTAGGATAGGTGATGTGCATGAAGCTAGAGCTATTTTTTATCGAGTTTTTGCTCGTGATTTGGTG
ATTTGGAACACTTTGATTGCTGGTTATGCACAGAATGGGTATTCTGATGATGCTATTGATGCTTTCTTTAATATGCAAGG
AGAAGGGTATGAACCGGATGCGGTAACGGTTTCTAGTATTTTATCTGCTTGTGCTCAATCTGGTCGTCTTGATGTTGGCA
GAGAAGTTCACTCTCTGATTAATCATAGAGGAATTGAGCTTAACCAGTTTGTTTCAAATGCTTTGATTGATATGTATGCG
AAATGTGGGGATCTAGAGAATGCGACATCCGTGTTTGAGTCGATAAGTGTGAGAAGTGTAGCATGTTGTAACTCTATGAT
CTCGTGTCTAGCCATACATGGGAAAGGCAAAGAAGCTTTAGAGATGTTCAGCACGATGGAGAGCTTAGATTTAAAGCCTG
ACGAGATCACTTTTATAGCGGTTCTCACTGCTTGTGTCCATGGAGGCTTTCTAATGGAAGGTCTAAAGATATTCTCGGAG
ATGAAAACTCAAGACGTGAAACCGAATGTAAAGCATTTTGGATGTTTGATACATCTCTTGGGACGCTCCGGGAAATTGAA
AGAAGCTTACAGATTGGTAAAAGAAATGCATGTGAAACCGAACGATACAGTATTGGGAGCTTTGCTTGGTGCATGTAAGG
TTCATATGGATACAGAAATGGCTGAACAAGTGATGAAGATCATCGAGACTGCTGGAAGCATCACTAACAGTTACAGCGAG
AACCATCTTGCATCGATATCGAACTTGTATGCACACACCGAAAGATGGCAAACAGCTGAAGCGTTGAGAGTAGAAATGGA
GAAAAGAGGTCTTGAGAAATCCCCAGGGCTTAGCTCACTAGTTTTGACCTGA