Details for Arabidopsis Locus AT3G21460

Position : Chr3 ( 5`- 7557384 .. 7557958 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21460

Protein [Map View]
MDVVARLASQRAVVIFSKSTCCMSHAIKRLFYEQGVSPAIVEIDQDMYGKDIEWALARLGCSPTVPAVFVGGKFVGTANT
VMTLHLNGSLKILLKEAGALWL*

DNA
ATGGATGTGGTAGCAAGATTAGCGTCGCAAAGAGCGGTGGTGATATTCAGCAAGAGTACGTGTTGCATGTCTCATGCAAT
TAAACGGTTGTTTTACGAGCAAGGTGTGAGCCCGGCAATTGTAGAGATCGACCAAGACATGTATGGGAAAGATATCGAGT
GGGCCTTGGCCCGATTAGGCTGTAGCCCTACGGTTCCTGCGGTTTTTGTTGGAGGGAAATTCGTAGGAACGGCCAATACT
GTCATGACTCTTCATCTCAATGGATCATTGAAAATATTGCTCAAGGAGGCTGGTGCTTTGTGGCTTTAG