Details for Arabidopsis Locus AT3G21450

Position : Chr3 ( 5`- 7553965 .. 7555236 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21450

Protein [Map View]
MEELRQATNNFDMDNTIGHGSHGTVYTGLIKDMPVVIKREWCSPQPRFLDEVHTNKKLVSYIQHKNLVNLLGYCCDDENQ
SLVFEYMVNGSVRDYLESSDLTFKKRISIALDAAKGLLHLHNLDPPVQHKRFTASKVLLDANLNAKVSDGAMLGLLQASD
IHLANPRGGSEETIDVYSFGLFLLELITCQNPGLLQSDYEVLQWNIPAETFTRPSFQAYLIITSECLEYPPINRPKMDVV
VTELETIYLNVISENHEVSLGSELFNITIE*

DNA
ATGGAGGAATTAAGGCAAGCAACGAACAATTTTGACATGGATAATACTATTGGGCATGGAAGTCACGGAACAGTTTACAC
TGGGCTGATCAAGGACATGCCCGTTGTGATCAAAAGGGAGTGGTGTAGTCCCCAACCTAGATTCTTGGATGAGGTACACA
CAAACAAAAAATTGGTTTCTTACATCCAACATAAAAATTTGGTTAATCTGCTCGGTTATTGTTGCGACGACGAGAACCAA
TCGCTCGTCTTTGAGTATATGGTCAACGGTAGCGTCCGAGATTATCTAGAGTCTAGCGACTTAACGTTCAAGAAAAGAAT
ATCTATAGCTCTTGATGCAGCCAAAGGGTTACTACACTTGCACAACTTAGATCCTCCAGTACAACACAAGAGATTTACGG
CGAGTAAAGTTTTGCTCGATGCCAACCTCAATGCCAAGGTATCAGATGGGGCAATGTTGGGACTGCTTCAAGCAAGTGAT
ATTCATCTCGCTAATCCAAGAGGTGGTTCAGAGGAGACAATTGATGTGTATAGCTTCGGGTTGTTCCTTCTAGAGCTTAT
CACCTGTCAAAACCCTGGACTGTTACAATCAGACTATGAAGTTTTACAATGGAATATACCTGCAGAAACATTCACGAGAC
CATCGTTCCAAGCTTATCTGATAATTACGTCGGAATGCTTGGAATATCCCCCGATAAATCGCCCAAAGATGGATGTGGTC
GTGACCGAGCTTGAGACGATTTACCTTAATGTCATCAGTGAGAACCATGAGGTTTCTCTAGGAAGTGAGCTTTTTAACAT
AACCATTGAGTAA