Details for Arabidopsis Locus AT3G21430

Position : Chr3 ( 5`- 7544628 .. 7553579 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21430

Protein [Map View]
MAPSRSKKSKYKKKPRAKAVSPHKDEESMSKTKQRKRKLSDMLGPQWSKEELERFYEGYRKFGKEWKKVAGFVHSRSAEM
VEALYTMNKAYLSLPEGTASVVGLTAMMTDHYSVLHGGSDSEQENNEGIETPRSAPKRSRVKSSDHPSIGLEGLSDRLQF
RSSSGFMPSLKKRRTETMPRAVGKRTPRIPISYTLEKDTRERYLSPVKRGLNQKGDDTDDDMEHEIALALAEASQRGGST
KNSHTPNRKAKMYPPDKKGERMRADIDLAIAKLHATDMEDVRCEPSLGSTEADNADYSGGRNDLTHGEGSSAVEKQQKGR
TYYRRRVGIKEEDAKEACSGTDEAPSLGAPDEKFEQEREGKALKFTYKVSRRKSKKSLFTADEDTACDALHTLADLSLMM
PETATDTESSVQAEEKKAGEAYVSDFKGTDPASMSKSSSLRNSKQRRYGSNDLCNPELERKSPSSSLIQKRRQKALPAKV
RENVLKDELAASSQVIEPCNSKGIGEEYKPVGRGKRSASIRNSHEKKSAKSHDHTSSSNNIVEEDESAPSNAVIKKQVNL
PTKVRSRRKIVTEKPLTIDDGKISETIEKFSHCISSFRARRWCIFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTRV
EWGVIRSSLGKPRRFSEQFLKEEKEKLYLYRDSVRKHYDELNTGMREGLPMDLARPLNVSQRVICLHPKSREIHDGNVLT
VDHCRYRIQFDNPELGVEFVKDTECMPLNPLENMPASLARHYAFSNYHIQNPIEEKMHERAKESMLEGYPKLSCETGHLL
SSPNYNISNSLKQEKVDISSSNPQAQDGVDEALALQLFNSQPSSIGQIQAREADVQALSELTRALDKKELVLRELKCMND
EVVESQKDGHNNALKDSESFKKQYAAVLFQLSEINEQVSLALLGLRQRNTYQENVPYSSIRRMSKSGEPDGQLTYEDNNA
SDTNGFHVSEIVESSRIKARKMVYRAVQALELLRKDENNNVNMEEAIDFVNNQLSIDQTEGSSVQQTQGGQDQRLPSTPN
PPSSTPANDSHLNQPDQNDLQVPSDLVSRCIATLLMIQKCTERQFPPSEVAQVLDSAVASLQPCCSQNLPIYTEIQKCMG
IIRNQILALVPS*

DNA
ATGGCGCCCTCAAGATCAAAGAAATCTAAGTACAAGAAGAAGCCTCGTGCTAAAGCTGTTTCTCCTCACAAAGACGAAGA
AAGTATGAGCAAAACTAAACAACGGAAGAGGAAGTTGTCGGACATGTTAGGTCCTCAGTGGAGCAAGGAAGAGTTAGAGC
GCTTTTATGAAGGATACCGCAAATTCGGAAAAGAATGGAAAAAGGTTGCTGGATTTGTACATAGCCGTTCTGCAGAAATG
GTAGAGGCCTTATACACTATGAATAAGGCTTACTTGTCTCTTCCGGAAGGCACTGCATCTGTGGTTGGCCTAACTGCAAT
GATGACGGATCACTACTCTGTTCTGCATGGAGGAAGTGACAGTGAGCAGGAAAATAATGAAGGCATTGAAACTCCGAGGT
CAGCCCCTAAGCGCTCTAGAGTAAAATCCTCAGATCATCCCTCTATAGGACTAGAGGGTCTGTCTGACCGCTTACAATTT
AGGTCCTCCTCAGGCTTCATGCCATCGCTGAAGAAGAGACGTACTGAGACTATGCCTCGTGCTGTTGGAAAAAGGACTCC
TAGAATTCCTATCTCATACACCCTTGAGAAGGATACTAGGGAAAGATATTTATCACCTGTTAAGAGAGGTTTAAATCAGA
AGGGGGATGATACTGATGATGATATGGAACATGAGATAGCATTAGCATTGGCTGAGGCTTCACAACGAGGTGGCTCTACA
AAGAACTCCCACACACCAAATAGAAAAGCAAAGATGTACCCCCCTGATAAAAAGGGTGAAAGAATGCGTGCCGATATTGA
CTTGGCGATTGCCAAGCTTCATGCCACTGATATGGAAGATGTCCGCTGTGAACCAAGCTTAGGAAGCACTGAAGCTGATA
ATGCGGATTATTCTGGAGGTAGAAATGACTTGACACATGGAGAAGGTTCTAGTGCCGTGGAAAAGCAGCAAAAAGGAAGA
ACATACTATAGGAGGAGAGTAGGCATTAAAGAAGAAGATGCAAAAGAAGCCTGCAGTGGTACAGATGAAGCACCAAGCTT
AGGCGCTCCCGATGAGAAATTTGAACAAGAAAGGGAAGGGAAGGCTTTGAAATTCACATATAAAGTTTCAAGGAGAAAAA
GTAAAAAAAGTCTTTTTACTGCAGATGAAGACACAGCATGTGATGCTCTCCATACGCTGGCAGATCTATCGCTGATGATG
CCTGAAACTGCCACTGATACTGAGTCATCAGTTCAAGCTGAGGAAAAGAAAGCTGGAGAAGCTTATGTTTCAGATTTTAA
AGGGACTGATCCGGCATCCATGTCTAAAAGTAGTTCTCTTAGAAACTCCAAACAGAGAAGATACGGCAGCAATGACCTTT
GTAACCCTGAACTCGAGAGAAAAAGTCCAAGTAGTTCTTTAATCCAAAAGAGACGGCAGAAAGCATTACCAGCTAAAGTA
AGAGAAAATGTTCTTAAAGATGAGCTTGCTGCAAGCTCACAAGTCATAGAGCCTTGTAATAGCAAGGGAATAGGTGAGGA
ATATAAGCCTGTTGGGAGAGGTAAACGGTCCGCAAGTATTCGAAACTCACATGAAAAGAAATCTGCCAAATCTCATGATC
ATACTTCGTCAAGTAACAACATAGTAGAAGAAGATGAGTCAGCTCCATCAAATGCAGTCATTAAAAAACAAGTTAACTTG
CCAACTAAAGTTAGGAGCAGAAGAAAGATAGTAACTGAGAAACCTCTAACTATTGATGACGGGAAAATTTCTGAGACTAT
AGAGAAGTTTTCGCATTGCATTTCTAGTTTCCGAGCACGGAGATGGTGTATTTTTGAGTGGTTCTACAGTGCAATTGACT
ATCCATGGTTTGCCAGACAAGAGTTTGTTGAGTATTTGGATCATGTAGGGTTGGGTCATGTTCCTAGATTAACTCGCGTT
GAATGGGGTGTCATAAGGAGTTCTCTTGGGAAACCAAGGCGATTTTCTGAACAGTTTTTGAAGGAGGAAAAAGAAAAGCT
ATACCTATACAGGGACTCTGTAAGAAAACATTATGATGAACTAAACACGGGCATGAGGGAAGGACTTCCAATGGATTTGG
CCCGGCCTCTAAATGTTTCACAGAGAGTCATTTGCCTGCATCCAAAGTCAAGAGAGATTCATGACGGCAATGTCCTAACT
GTTGATCACTGTAGGTACCGGATTCAGTTTGACAACCCTGAATTAGGGGTAGAATTTGTTAAGGATACTGAATGCATGCC
ACTGAATCCTCTAGAAAACATGCCAGCATCGCTGGCAAGGCACTATGCTTTCTCAAATTATCACATTCAGAATCCCATTG
AGGAGAAAATGCATGAACGGGCAAAGGAAAGCATGCTGGAAGGATATCCCAAACTTTCGTGTGAGACAGGCCATCTCTTG
TCCTCTCCAAATTATAACATTAGCAATTCACTAAAGCAGGAAAAGGTAGATATCTCAAGTTCAAATCCACAAGCTCAAGA
CGGAGTTGATGAGGCTCTTGCTTTACAATTGTTTAATTCTCAGCCCTCAAGTATTGGACAAATCCAGGCAAGAGAAGCTG
ATGTCCAAGCTCTTTCTGAACTAACGCGTGCGCTTGACAAGAAGGAGCTAGTTTTGAGGGAGCTAAAATGCATGAACGAC
GAGGTTGTGGAAAGTCAGAAAGATGGACATAATAATGCCCTAAAGGATTCTGAATCTTTTAAGAAACAATATGCAGCAGT
TCTCTTTCAGCTAAGCGAAATCAATGAGCAGGTTTCATTGGCACTTCTTGGCTTGAGGCAACGAAATACTTACCAGGAGA
ATGTACCATATTCATCAATAAGACGCATGAGTAAATCAGGGGAACCTGATGGTCAGTTGACATACGAAGACAATAATGCA
TCAGACACTAATGGATTCCATGTGTCTGAGATCGTCGAAAGTTCTAGAATAAAAGCACGGAAAATGGTATACAGAGCTGT
ACAGGCATTGGAGTTACTGAGAAAAGACGAAAATAATAATGTAAATATGGAAGAAGCCATTGATTTTGTAAATAATCAGC
TCTCAATAGATCAAACAGAAGGATCATCAGTCCAGCAAACACAAGGTGGCCAGGATCAGCGTCTTCCCTCTACACCAAAT
CCACCTAGCTCAACTCCTGCCAATGATTCCCACCTAAACCAACCCGATCAAAATGACCTGCAAGTCCCGTCCGATCTTGT
GTCCCGATGTATCGCTACATTGCTTATGATTCAGAAATGTACAGAGAGGCAATTCCCACCAAGTGAAGTAGCCCAGGTTC
TAGACTCGGCAGTGGCGAGTTTACAGCCTTGCTGCTCGCAGAACCTTCCGATCTATACAGAGATTCAGAAGTGCATGGGA
ATCATAAGAAACCAGATTCTAGCCCTCGTACCCTCCTAA