Details for Arabidopsis Locus AT3G21410

Position : Chr3 ( 5`- 7536719 .. 7537951 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21410

Protein [Map View]
MAWFQHVKLYIASCINLFTKIQKPYLSMAMDSKECSLLPFELFEEILCRVPTKSLLRLKLTCKRWLALFNDKRFIYKHLA
LVREHIIRTNQMVKIINPVVGACSSFSLPNKFQVKGEIYTMVPCDGLLLCIFETGSMAVWNPCLNQVRWIFLLNPSFRGC
SCYGIGYDGLSRDSYKILRFVNGVFTKNEYANTGSYKPEVDIYELKSNSWKTFKVSLDWHVVLRCKGLSLKGNMYWIAKW
NRKPDIFIQSFNFSTETFEPLCSLPVRYDVHNVVALSAFKGDNLSLLHQSKETSKIDVWVTNKVKNGVSILWTKLFSVTR
PDLPVLLAFENLSYPVHFIDKNNRIVVCCEEVLADKRNVAVNIYVIGEDEIKSQDEIEQHQLGFSWPFISGYTYLPSLVP
VPSSEDNTPE*

DNA
ATGGCGTGGTTCCAACATGTTAAATTATATATAGCTTCATGCATAAATCTATTCACAAAGATCCAGAAGCCATACCTCTC
CATGGCCATGGATTCCAAAGAATGTTCATTGTTGCCTTTTGAGTTATTTGAAGAAATACTTTGTAGGGTTCCAACTAAAT
CTCTTTTACGACTCAAGTTGACGTGCAAACGATGGCTCGCTCTTTTCAACGACAAGAGATTCATTTACAAGCACTTAGCT
CTTGTTCGGGAACATATCATAAGGACCAATCAAATGGTTAAGATCATCAACCCGGTAGTTGGAGCTTGCTCATCTTTTTC
ACTTCCTAACAAGTTTCAAGTGAAAGGTGAGATTTATACTATGGTTCCCTGCGACGGGTTATTGTTATGCATTTTCGAAA
CAGGTTCAATGGCAGTTTGGAACCCATGTTTGAACCAGGTTAGATGGATCTTTCTCCTGAATCCTTCTTTCCGGGGTTGT
AGTTGCTACGGCATTGGATATGACGGTTTATCTCGGGATAGCTACAAAATCTTGAGGTTCGTAAACGGTGTTTTTACCAA
AAACGAGTATGCAAATACGGGCTCTTACAAACCAGAGGTTGATATTTATGAATTAAAGTCTAATTCTTGGAAAACTTTTA
AAGTTTCTTTGGATTGGCATGTGGTTTTGCGTTGTAAAGGTTTGTCACTCAAAGGAAACATGTATTGGATTGCTAAATGG
AACCGTAAACCCGACATCTTCATCCAAAGCTTTAACTTCTCTACAGAGACATTTGAGCCCTTGTGCTCTCTTCCCGTTAG
GTATGATGTACATAATGTTGTAGCTTTATCAGCTTTCAAAGGAGACAATCTTTCTTTGTTACACCAAAGCAAAGAAACAT
CAAAGATCGATGTATGGGTTACTAACAAGGTTAAGAACGGAGTGAGTATCTTATGGACCAAGTTATTTAGTGTGACAAGA
CCTGATCTCCCGGTATTGCTGGCTTTTGAGAATCTTTCTTATCCGGTGCATTTCATTGATAAGAATAATAGGATCGTAGT
ATGTTGTGAGGAAGTATTGGCAGATAAAAGAAACGTAGCCGTCAACATCTACGTTATTGGAGAGGATGAGATCAAAAGCC
AAGATGAGATAGAACAACACCAACTAGGTTTTAGTTGGCCTTTTATCTCCGGCTATACATATCTTCCAAGTCTTGTTCCG
GTTCCATCATCGGAGGATAATACACCAGAATAA