Details for Arabidopsis Locus AT3G21390

Position : Chr3 ( 5`- 7531402 .. 7534544 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21390

Protein [Map View]
MSGTELDEPGKLKRAVIDASAGGVAGAISRMVTSPLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFREEGL
SGFWRGNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVLASQGEP
KVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYDTFKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLC
GLASGTVSKLVCHPLDVVKKRFQVEGLQRHPKYGARVELNAYKNMFDGLGQILRSEGWHGLYKGIVPSTIKAAPAGAVTF
VAYELASDWFEANLT*

DNA
ATGAGTGGTACAGAGTTAGATGAGCCTGGAAAGTTAAAACGTGCTGTCATTGATGCTTCTGCTGGTGGTGTTGCTGGTGC
GATTTCACGTATGGTTACCTCTCCCCTTGATGTTATCAAGATTAGATTTCAGGTTCAGTTGGAGCCTACAGCTACATGGG
CTCTGAAAGATTCTCAGCTGAAACCGAAGTACAATGGTTTGTTTCGAACAACGAAGGATATCTTTAGAGAGGAAGGTTTA
TCGGGTTTCTGGCGTGGAAATGTTCCAGCTTTACTTATGGTTGTGCCTTATACATCCATACAATTTGCAGTCTTACATAA
GGTGAAGTCTTTTGCCGCTGGTTCATCAAAGGCCGAAAATCATGCTCAACTGAGCCCTTATCTTTCTTACATCAGTGGGG
CACTAGCAGGGTGTGCAGCAACAGTTGGATCGTATCCGTTTGACCTATTGCGGACTGTATTGGCGTCCCAGGGTGAGCCA
AAGGTGTATCCAAATATGAGGTCAGCATTTCTGAGTATAGTGCAAACTCGTGGAATCAAAGGGTTGTATGCAGGATTGTC
CCCTACTCTGATCGAGATCATTCCTTATGCTGGTCTGCAGTTTGGCACCTATGACACATTTAAACGCTGGAGTATGGTAT
ATAATAAGCGATACCGATCTTCTTCATCAAGCTCAACGAATCCAAGTGATAGTCTTTCTAGCTTTCAGCTTTTCCTTTGC
GGTTTAGCTTCGGGCACTGTTTCTAAACTAGTCTGTCATCCGCTTGATGTTGTCAAGAAAAGATTCCAGGTCGAAGGTCT
GCAACGTCACCCAAAATATGGAGCCCGAGTAGAGCTGAATGCTTACAAGAACATGTTTGACGGTTTAGGGCAGATATTAA
GATCTGAAGGTTGGCACGGGCTTTATAAAGGCATTGTTCCATCAACCATTAAAGCTGCACCTGCTGGTGCTGTAACATTT
GTGGCCTATGAACTTGCATCCGATTGGTTTGAGGCAAATTTGACCTGA