Details for Arabidopsis Locus AT3G21360

Position : Chr3 ( 5`- 7522804 .. 7524580 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21360

Protein [Map View]
MAELLLVETPIPQQKHYESKPFPAVISPPSASIPIPALSLPLFTQTIKTQKHYLDSLLHESGAVLFRGFPVNSADDFNDV
VEAFGFDELPYVGGAAPRTSVVGRVFTANESPPDQKIPFHHEMAQVREFPSKLFFYCEIEPKCGGETPIVLSHVVYERMK
DKHPEFVQRLEEHGLLYVRVLGEDDDPSSPIGRGWKSTFLTHDKNLAEQRAVDLGMKLEWTEDGGAKTVMGPIPAIKYDE
SRNRKVWFNSMVAAYTGWEDKRNDPRKAVTFGDGKPLPADIVHDCLRILEEECVAVPWQRGDVLLIDNWAVLHSRRPFDP
PRRVLASLCK*

DNA
ATGGCGGAACTGTTGTTGGTGGAAACTCCAATCCCACAGCAAAAGCACTACGAATCCAAACCATTCCCGGCGGTGATATC
ACCACCGTCTGCTTCGATTCCAATTCCTGCTCTGTCTCTCCCACTATTCACTCAAACTATCAAAACTCAGAAACACTATC
TCGATTCTCTCTTGCACGAATCCGGAGCAGTGCTATTCAGAGGTTTTCCGGTGAATTCCGCCGATGATTTCAACGACGTC
GTTGAAGCTTTCGGTTTCGATGAGCTTCCTTACGTCGGAGGCGCTGCTCCTCGCACTAGCGTCGTCGGTCGTGTCTTCAC
TGCTAATGAATCTCCTCCTGATCAGAAGATTCCTTTTCACCACGAGATGGCTCAGGTTCGTGAGTTTCCATCAAAGTTGT
TCTTTTACTGTGAGATTGAGCCTAAGTGTGGTGGAGAGACTCCAATTGTGTTGAGTCATGTTGTGTATGAGAGAATGAAA
GATAAACATCCAGAGTTTGTTCAGAGATTAGAGGAACATGGTTTGCTTTATGTTAGGGTTTTAGGTGAAGATGATGATCC
TTCATCTCCCATTGGACGTGGTTGGAAATCTACATTCTTAACCCATGACAAGAACCTTGCTGAGCAAAGGGCGGTTGATT
TGGGAATGAAACTGGAATGGACAGAGGATGGTGGAGCCAAGACGGTAATGGGTCCGATTCCGGCTATCAAATATGACGAG
TCGAGAAACCGTAAAGTATGGTTTAACAGCATGGTAGCTGCTTATACGGGATGGGAGGATAAGCGGAATGATCCAAGAAA
GGCTGTGACTTTTGGGGATGGAAAGCCTTTACCTGCGGATATAGTCCATGATTGTCTTAGGATTCTTGAAGAGGAATGTG
TTGCTGTTCCGTGGCAGAGAGGAGATGTTTTGCTTATAGATAACTGGGCGGTTCTTCATTCTCGAAGACCGTTTGATCCT
CCTCGTCGAGTTCTTGCATCACTCTGCAAATAG