Details for Arabidopsis Locus AT3G21351

Position : Chr3 ( 5`- 7518924 .. 7519477 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21351

Protein [Map View]
MKTGSARSTILLYVLFLALVLSPTLPCQAASVPLGGRKMMAPPPPILMCTQCACCAPAPPGSCCRCGCSGGP*

DNA
ATGAAAACCGGGTCAGCAAGGTCTACCATCCTCCTATATGTTTTATTTCTCGCACTGGTCTTGTCTCCAACACTTCCATG
TCAAGCAGCTAGTGTCCCTCTAGGAGGGCGTAAGATGATGGCGCCACCACCACCTATTCTCATGTGTACACAGTGTGCAT
GTTGTGCACCGGCTCCACCCGGTTCTTGCTGCCGTTGTGGCTGTTCTGGTGGTCCCTGA