Details for Arabidopsis Locus AT3G21295

Position : Chr3 ( 5`- 7489236 .. 7492602 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21295

Protein [Map View]
MGSSDERNCKAIDASVGGLVWVRRRNGAWWPGRIMAHHEVPDGTIVSPKSGTPIKLLGRDDASVDWYNLEKSKRVKAFRC
GEYDACIATAKATASTTGKKAVKYARREDAIAHALEIENAHLAKDHPPCIEKASTSGEVSRKGIEDSGDVAETEVALQST
MSLKKTKNGKASKVQPLSEKRRRTPNDSEDDGTQTNKRMRGLEDIGMGTGSKGKVQVGALLEDTQENGFKSDTNNINDSV
SNGSLSNGSSRDCSPSMKRKRSPVVIANDYSKRKNRRRTLTKVLESTATVSIPGTCDKLVNSDCLSLPGVSESDNNSDSN
EVFSENVSENIVEVINDKGKESEVSNISVLAKDDSSNGLFDVPLNGDEKYPSGISTVPFTSSSPRKALVSGPTRRFGQSS
HDDVVKSEGSNGSPSTSPAATLFNGIKKSTSKWQLKGKRNSRQMSKKQVERRNAYAEEANNNALPHWSVSDQKPRSLFSV
GTQAMGRNSELYDVKIEVKANYKPRNVPLISLRSKLNGEAIVGHPSVVEVLEDGSCGHIVSSHRIDDAKPKPSSKKKSKK
KKPHFPPQASKSKKSSSLAIKTRCLSALSGQKLTLSSKKKVMIESTKERIVACIPLKVVFSRINEAVKGSARQVHRSLPS
AGNTG*

DNA
ATGGGTAGTAGTGATGAGCGAAACTGTAAGGCGATTGATGCGTCGGTAGGAGGTTTGGTTTGGGTCCGACGTCGTAACGG
GGCTTGGTGGCCGGGTCGGATTATGGCTCATCACGAGGTTCCTGACGGTACTATTGTTTCTCCTAAATCTGGTACTCCTA
TTAAGCTTCTAGGTCGTGACGATGCTAGCGTGGATTGGTATAATCTTGAAAAGTCCAAGAGAGTGAAGGCGTTTCGTTGT
GGGGAGTATGATGCTTGTATTGCGACGGCAAAGGCTACTGCATCGACTACTGGTAAGAAGGCTGTCAAGTATGCCCGTAG
AGAAGATGCTATTGCTCATGCTCTTGAGATTGAGAATGCACACCTTGCCAAAGATCACCCTCCGTGTATTGAGAAGGCTA
GTACATCTGGTGAAGTTTCCAGAAAGGGTATTGAGGACTCGGGTGATGTGGCAGAGACTGAAGTTGCATTGCAATCTACT
ATGTCTTTGAAAAAAACCAAGAACGGCAAAGCTTCTAAGGTGCAGCCTTTGTCAGAAAAGAGAAGAAGAACACCAAATGA
CTCGGAAGATGATGGGACTCAAACAAACAAACGAATGAGAGGACTTGAGGATATTGGAATGGGTACTGGATCGAAAGGGA
AAGTACAGGTCGGTGCACTGCTCGAGGATACGCAGGAAAATGGTTTTAAAAGTGATACAAACAACATCAATGATTCTGTG
TCAAATGGGAGTCTTTCCAATGGCAGTAGCAGGGATTGCTCTCCGTCAATGAAAAGAAAAAGGTCGCCTGTCGTCATTGC
GAATGACTACTCTAAAAGGAAAAACCGACGACGGACACTGACAAAAGTGTTAGAGAGTACAGCTACGGTGTCTATCCCTG
GTACCTGTGACAAACTTGTCAATTCTGATTGTTTGTCTCTTCCAGGGGTTTCTGAAAGCGATAATAACTCGGACAGCAAT
GAGGTTTTCTCTGAGAATGTTTCTGAAAATATTGTTGAAGTGATCAATGACAAGGGGAAAGAGAGTGAAGTCTCGAACAT
ATCAGTTTTGGCAAAGGATGACTCATCCAATGGATTATTTGATGTTCCACTAAATGGAGATGAAAAATACCCTTCAGGTA
TTTCGACGGTGCCTTTCACATCTTCTTCACCCAGGAAGGCTCTTGTTTCTGGACCGACGAGACGGTTTGGTCAGAGTAGC
CATGATGATGTGGTGAAAAGCGAAGGAAGTAATGGATCTCCTAGTACAAGTCCAGCAGCTACACTTTTCAATGGGATTAA
GAAGAGCACTTCTAAATGGCAGCTAAAAGGGAAAAGGAATTCAAGGCAGATGAGTAAAAAACAAGTAGAAAGAAGAAATG
CGTACGCCGAAGAAGCCAACAACAATGCTTTACCTCATTGGTCTGTCTCTGATCAAAAGCCACGCAGTCTTTTCAGCGTT
GGCACTCAAGCTATGGGAAGAAATTCTGAACTGTATGACGTGAAGATCGAGGTAAAAGCTAACTATAAACCCCGTAATGT
TCCGCTGATTTCCCTTAGGAGTAAACTGAATGGTGAAGCTATTGTCGGGCATCCTTCAGTGGTTGAAGTGCTTGAAGATG
GATCATGTGGCCACATTGTGAGTAGTCATAGAATTGATGATGCGAAGCCAAAACCATCATCAAAAAAGAAATCCAAGAAA
AAGAAACCACATTTTCCTCCACAGGCATCAAAGTCGAAGAAATCTTCATCTCTAGCAATAAAGACAAGGTGTCTCTCCGC
TCTAAGTGGCCAGAAGCTGACACTAAGTAGCAAGAAAAAGGTAATGATAGAGTCGACGAAAGAACGAATTGTAGCTTGCA
TCCCTCTGAAAGTAGTCTTCAGTAGGATAAACGAAGCAGTGAAGGGCTCAGCGAGACAAGTGCACAGATCATTACCATCT
GCAGGTAATACAGGATGA