Details for Arabidopsis Locus AT3G21290

Position : Chr3 ( 5`- 7482131 .. 7488935 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21290

Protein [Map View]
MFKGSSKRGGRGGSGGGGSGPSRNRNSFPPPTNRHPSPIGRMSSGGGGGGSAAPRQRSNSTSVKAAASTTVSSRTVEETF
NLVPRESSSAFGMIIRLSPDLVDEIKRVEAQGGAAKIKFDAFPNNSTENIINVGGKEFKFTWSGEKGELCDIYEEHQSGE
DGNGLLIEAGCAWRKLNVLRTLDESTTSHMKMRSVEAEQRTKSRKAIVLDPGNPSVTKQLAHAEGSPWRMSNKQKKEPPP
KKRKVDPPPVPVGGPKPSFRPGASTPTMKNRLSASPGPSPSNQYNTPPYGIGNMAKTHAANENVTPVQTKGRVNMIEKEP
SAWKNNVLRDTSGREAINVNKEIDLQSLLVDILKEAPMSLKALEKAVGDKVPNPAKKIEPILKRIANFQAPRYFLKPEAE
LESYKKHSPDSGSSPEHQQLLPVTECSRDQLPVPGRNNTEKFSLCEQNGEGSLDCLPVHLVEQLSTQENVDIEHHSPGIF
HEEKRSENREAQARSSSDSDSDSDNSDSGSDSKSAAGSDSGSSSDSEASSNSKDGSDEDVDIMSDGDREPLLTTQSLEQD
AIDLPGHGSSAVEIEGHNSDAVDIDGHDSDAVDIDGHGSDTVDVEGNSSDEGHGSDADRKKNSDNNWKMETTTGTSPTAN
GEVGISGQEHFTSGHDNLRERQNFIGQLFDDTENTTKNNFKNDKRDISERLGKDQNQKALDFEHYSQKSAHEKNRKSQSC
NQLSAVSKDSQHSELKYDAELRNASASQTIDPLRGLLKSSIEKSNRHGKSNKHSDALGNVRKSDKGDHFPLEMLSSRSGK
AFRDNQRDDVHLKNKFPRNKKDGESAIRPSLPTETSDRKPDELDGSDKDPKNVSGLSIGSSPLDSQRTYLAKLPKGNGPV
LQKQVSELELGELPEPLGEDTALKPIEEKTSFRQSNLKPSTSEKLGIDSDKRRSKKSDSKKAAPPHTVNGSNEHVVEDSE
RSQKWALQSHGQNLTGTDTEISSQNKNLEDAAYKSRQKDSRARVGNSVEGYGETNKKTPVVKHGSKRASTSRSSRESKRH
SSVSNSINGHKDATSIPGGSVVREKQMTSFGEEDSSYLKYEKASPELKGPISDHLQYKAYMQEYNDKYDSYHSINKILES
HRNDFQKLGQDLGFAKGRDVERYNKIVEQIKESYCKYGERHKRLKKVFVVLHEELKHLKQRMRDYASSHGKD*

DNA
ATGTTCAAAGGATCGTCGAAACGTGGCGGTAGAGGAGGAAGTGGTGGTGGGGGCAGTGGACCTTCCCGTAACCGTAATTC
ATTCCCTCCTCCTACAAACCGACATCCTTCTCCCATCGGGAGGATGTCTTCTGGTGGTGGTGGTGGTGGCTCCGCCGCTC
CACGCCAGCGGAGTAATTCTACTAGCGTTAAGGCGGCTGCGTCGACTACGGTGTCGTCGCGGACGGTTGAGGAAACGTTT
AATCTTGTTCCGAGGGAGAGTTCTTCGGCTTTTGGAATGATTATAAGGTTATCTCCTGATTTGGTGGATGAGATCAAGCG
TGTGGAGGCACAAGGTGGAGCTGCCAAGATCAAGTTCGATGCGTTTCCTAACAATAGCACTGAGAATATAATTAATGTTG
GTGGAAAGGAGTTCAAATTTACTTGGTCTGGGGAGAAAGGTGAGTTATGTGATATATATGAAGAACATCAAAGTGGTGAA
GATGGAAATGGTTTGCTGATTGAGGCTGGATGTGCTTGGCGAAAATTGAACGTCCTACGAACTCTAGATGAGTCAACCAC
AAGCCATATGAAGATGCGCTCAGTTGAAGCTGAACAGAGAACCAAATCACGCAAGGCCATTGTTTTAGATCCTGGGAATC
CATCAGTAACGAAGCAGTTAGCTCATGCTGAAGGAAGTCCATGGAGAATGTCAAATAAACAGAAGAAGGAACCTCCACCT
AAGAAGCGGAAAGTTGATCCACCACCAGTTCCAGTCGGAGGTCCAAAGCCTTCTTTCAGACCAGGGGCTTCTACCCCTAC
TATGAAAAATAGGCTATCAGCTTCACCCGGACCGTCTCCTAGTAATCAATACAATACCCCTCCATATGGGATTGGGAATA
TGGCTAAAACTCATGCAGCTAACGAGAATGTCACACCAGTCCAGACAAAGGGCAGAGTGAACATGATCGAAAAAGAACCA
TCAGCCTGGAAAAATAATGTATTAAGGGACACATCTGGGCGCGAAGCAATTAATGTTAATAAAGAAATTGACTTGCAGTC
ACTGCTCGTTGATATCCTAAAAGAGGCTCCAATGAGCTTGAAGGCTTTAGAGAAAGCTGTTGGAGATAAAGTTCCTAATC
CCGCAAAGAAGATTGAACCAATTTTGAAAAGGATCGCAAATTTCCAAGCTCCAAGGTATTTCTTAAAACCAGAAGCAGAG
TTGGAAAGCTATAAAAAACATTCACCTGATAGCGGAAGTTCACCTGAACACCAACAATTGCTGCCAGTCACTGAGTGCAG
TCGCGATCAGTTACCTGTTCCAGGAAGAAATAACACAGAGAAATTTTCTTTGTGCGAGCAGAACGGAGAAGGTTCACTAG
ACTGTTTACCTGTGCATCTAGTAGAGCAACTGAGTACGCAGGAAAATGTTGACATTGAGCATCATTCACCTGGTATTTTT
CATGAGGAAAAACGATCTGAGAATAGAGAAGCCCAGGCTCGTAGCTCTAGTGATAGTGACAGTGATAGTGATAACAGTGA
CAGTGGGAGTGACAGTAAAAGTGCAGCTGGAAGTGACAGTGGGAGCAGCAGTGATAGTGAGGCTTCTTCTAACAGTAAGG
ACGGTTCTGATGAGGACGTGGATATCATGAGTGATGGTGACAGAGAGCCTCTACTGACAACACAGTCCCTTGAACAGGAT
GCAATTGATCTCCCAGGTCATGGTTCTAGTGCAGTTGAAATCGAGGGTCATAATTCTGATGCTGTTGACATTGACGGTCA
TGATTCTGATGCAGTTGATATTGATGGTCATGGGTCTGATACAGTTGATGTCGAGGGGAACAGTTCAGATGAGGGTCATG
GTTCTGACGCTGACAGAAAAAAAAATTCTGATAATAACTGGAAAATGGAAACAACAACTGGTACCAGTCCCACTGCAAAT
GGAGAAGTTGGCATTTCAGGGCAGGAACATTTTACTTCTGGTCACGACAACCTACGAGAACGCCAAAATTTTATTGGACA
GTTGTTTGATGACACAGAGAATACAACAAAGAATAACTTTAAAAATGACAAACGTGACATCTCCGAGAGGCTGGGGAAAG
ACCAGAACCAAAAAGCCCTTGATTTTGAGCACTACAGTCAGAAATCAGCACATGAGAAAAATAGAAAATCCCAGAGCTGC
AATCAGTTATCTGCCGTAAGTAAAGATTCACAGCATTCAGAGCTCAAGTATGATGCCGAACTTCGCAACGCTTCTGCCAG
TCAAACGATCGATCCACTTAGAGGACTTCTGAAGTCATCTATTGAAAAGTCGAATAGACATGGTAAATCAAACAAACATT
CTGATGCCTTAGGAAATGTTCGTAAATCTGACAAAGGGGACCATTTTCCACTTGAAATGCTTTCTAGTCGCTCAGGAAAG
GCCTTCAGGGACAATCAGAGAGATGATGTTCATTTGAAAAATAAGTTTCCAAGGAATAAAAAAGATGGTGAGTCAGCCAT
TCGACCTTCATTACCTACCGAGACATCCGATAGAAAGCCCGATGAACTGGATGGAAGTGACAAGGATCCCAAGAATGTTT
CAGGCTTGAGCATAGGTTCTTCTCCCTTAGATAGCCAGAGAACATATTTGGCGAAATTACCTAAGGGAAATGGACCTGTC
CTCCAAAAACAAGTTTCGGAATTGGAGTTGGGTGAACTCCCTGAGCCATTGGGTGAAGATACAGCATTGAAGCCGATCGA
AGAGAAAACTTCGTTTAGGCAGTCAAATTTAAAACCAAGCACTTCAGAGAAATTGGGTATTGACTCGGATAAACGAAGGT
CTAAAAAATCTGACTCAAAAAAGGCAGCTCCTCCACATACAGTAAATGGTAGCAACGAACACGTTGTTGAAGATTCAGAA
AGATCCCAAAAGTGGGCTTTGCAGTCACATGGGCAGAACCTTACAGGTACAGATACTGAAATCAGCTCACAGAATAAAAA
TTTAGAAGATGCAGCTTATAAATCTAGACAAAAAGATAGTAGAGCAAGAGTAGGGAACAGTGTGGAAGGTTATGGAGAAA
CAAACAAAAAAACGCCTGTTGTAAAGCATGGCTCCAAACGAGCATCCACATCCCGCTCTTCAAGGGAGAGCAAAAGACAT
TCGTCTGTCTCAAATTCAATCAATGGACACAAAGATGCAACTTCAATACCAGGTGGCAGTGTTGTCCGGGAGAAACAAAT
GACATCTTTCGGTGAAGAAGACTCTTCTTATTTGAAATACGAGAAAGCTTCTCCTGAGCTTAAGGGACCTATTAGTGATC
ATTTGCAGTATAAAGCCTATATGCAGGAGTATAATGATAAATATGATAGCTACCACTCCATTAACAAGATATTAGAGAGC
CACAGAAATGACTTTCAAAAGTTGGGGCAAGACCTTGGGTTTGCAAAAGGAAGGGATGTGGAGAGATATAACAAAATTGT
GGAGCAGATAAAGGAATCTTATTGCAAATATGGGGAGAGACACAAACGTTTGAAGAAAGTATTTGTTGTTCTCCACGAAG
AATTGAAGCACCTGAAACAAAGAATGAGAGACTACGCATCATCTCATGGAAAAGATTGA