Details for Arabidopsis Locus AT3G21250

Position : Chr3 ( 5`- 7457433 .. 7463525 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21250

Protein [Map View]
MAAFIGSLPWCDVELNLASSCFQRTAIAFVNLLFLCIFYLFLIASCVSTHFIVRGRKKGWIFVAVAICCAITSFIFLGVG
LNSLIHGGNDVTEISWVACFVEGIIWVSLAVSLLVNGSKWVNILVSVWWVSFALLDLVAKSGILLQGNGIRILDILTLPM
SLLLLLCSWMNLRSSSAAAQDCSVTGLSDPLLTKNPRKESARLATAGFFSILSFSWMNPLLSLGFKKPLSPEDIPSVVPE
DEAQLAYKKFSQAWDTLLGDESSTKERNLVFRAVVKVYFKENIFIAVFAFLRTFAVVSLPLMLYVFVDYANSDHRDLRNG
FFNLACLVMLKLVESLTMRHWYFASRRSGMRIRSALMVAAYKKQLKLSSLGRKRHSSGEIVNYIAVDAYRMGEFLWWFHS
GWSLSLQLLLSTAVLFGVVGAGAFPGLILLLLCGLLNLPFAKMLQNCQTQFMIAQDKRLRSTSEILNSMKVIKLQSWEDE
FKKKIESCRDDEFTWLAKAQLTKAFGSFLYWMSPTIVSSVVFLGCALLKSAPLNASTIFTVLATLRVMSEPVKIIPDAIS
AIIQGNVSFQRLNNFLLDDELKMDEIERSGLDASGTAVDIQVGNFGWEPETKIPTLRNIHLEIKHGQKVAVCGPVGAGKS
SLLHAVLGEIPKVSGTVKVFGSIAYVSQTSWIQSGTIRDNILYGKPMESRRYNAAIKACALDKDMNGFGHGDLTEIGQRG
INLSGGQKQRIQLARAVYADADVYLLDDPFSAVDAHTAGVLFHKCVEDSLKEKTVILVTHQVEFLSEVDQILVMEEGTIT
QSGKYEELLMMGTAFQQLVNAHNDAVTVLPLASNESLGDLRKEGKDREIRNMTVVEKIEEEIEKTDIPGVQLTQEEEKES
GYVGMKPFLDYIGVSRGWCLLWSSVLGQVGFVVFQAASTYWLAFAIGIPKITNTMLIGVYSIISTLSAGFVYARAITTAH
LGLKASKAFFSGFTNAVFKAPMLFFDSTPVGRILTRASSDLNVLDYDVPFAFIFVVAPAVELTAALLIMTYVTWQVIIIA
LLALAATKVVQDYYLASARELIRINGTTKAPVMNYAAETSLGVVTIRAFGTAERFFKNYLNLVDADAVLFFLSNAAMEWV
ILRIETLQNVTLFTCALLLILIPKGYIAPGLVGLSLSYALTLTQTQVFLTRWYCTLSNSIISVERIKQYMNIPEEPPAII
DDKRPPSSWPSNGTIHLQELKIRYRPNAPLVLKGISCTFREGTRVGVVGRTGSGKSTLISALFRLVEPASGCILIDGIDI
SKIGLKDLRMKLSIIPQEPTLFRGCIRTNLDPLGVYSDDEIWKALEKCQLKTTISNLPNKLDSSVSDEGENWSVGQRQLF
CLGRVLLKRNKILVLDEATASIDSATDAIIQRIIREEFADCTVITVAHRVPTVIDSDMVMVLSFGDLVEYNEPSKLMETD
SYFSKLVAEYWASCRGNSSQNLQL*

DNA
ATGGCGGCTTTTATTGGGAGCCTTCCATGGTGTGACGTTGAATTGAATTTGGCCTCTTCTTGCTTCCAAAGAACGGCTAT
AGCTTTTGTAAATTTGTTGTTCCTCTGCATCTTCTACTTGTTCTTGATAGCTAGTTGTGTTTCTACACATTTTATAGTCA
GGGGTCGTAAGAAAGGATGGATCTTTGTGGCTGTAGCTATATGTTGTGCTATTACTAGCTTCATTTTTCTTGGTGTTGGG
TTAAACAGTCTGATTCATGGTGGTAATGACGTCACTGAGATCTCTTGGGTTGCTTGCTTTGTTGAAGGGATCATTTGGGT
CTCACTTGCTGTTTCTTTGCTTGTCAATGGATCCAAGTGGGTGAATATTCTTGTATCTGTTTGGTGGGTGTCTTTTGCTT
TGTTGGATTTAGTTGCAAAGAGTGGGATACTTTTGCAGGGAAATGGTATCCGAATCCTCGACATTTTAACCTTGCCAATG
AGTCTTTTGCTTCTCCTTTGTTCATGGATGAATTTGAGATCTTCTTCTGCAGCAGCTCAAGATTGTAGTGTAACAGGACT
TTCTGATCCTCTTTTAACTAAAAATCCTAGAAAAGAATCGGCGAGGTTAGCAACAGCTGGATTTTTCAGCATTCTATCTT
TCTCTTGGATGAATCCTTTACTCTCGCTGGGATTCAAGAAACCATTATCCCCTGAAGATATCCCAAGTGTAGTCCCGGAG
GATGAGGCTCAATTAGCTTACAAGAAATTTTCTCAAGCATGGGATACTCTTCTTGGAGATGAAAGCTCAACTAAGGAAAG
AAACTTGGTGTTTAGAGCCGTTGTGAAAGTTTACTTTAAAGAAAACATTTTCATAGCAGTTTTTGCATTTCTCAGAACAT
TTGCTGTTGTTTCTCTTCCATTAATGCTATATGTCTTTGTGGATTATGCAAACAGTGACCACAGGGATCTCCGCAATGGG
TTCTTCAACTTAGCTTGTCTAGTTATGCTGAAACTAGTTGAATCCTTGACAATGAGACATTGGTATTTTGCATCAAGAAG
ATCAGGAATGAGGATTAGATCAGCGCTAATGGTAGCTGCATACAAAAAACAGCTAAAGCTATCAAGTTTAGGGAGGAAAA
GGCATTCATCTGGAGAGATTGTGAATTATATCGCGGTGGATGCATATCGTATGGGAGAATTCTTATGGTGGTTCCACTCG
GGATGGAGCCTTTCGCTGCAGCTTTTGCTTTCTACAGCTGTACTTTTTGGAGTGGTTGGTGCAGGAGCTTTTCCAGGTTT
AATTCTTCTTCTCCTATGTGGTCTGCTGAATCTACCATTTGCAAAGATGCTACAGAACTGCCAGACACAGTTCATGATCG
CGCAGGATAAGCGATTGAGGTCCACCTCAGAGATTTTGAACAGTATGAAAGTCATTAAGCTGCAGTCATGGGAAGATGAG
TTCAAGAAAAAGATAGAATCTTGTCGTGATGATGAATTCACATGGTTGGCTAAAGCTCAGCTGACAAAGGCCTTTGGTTC
TTTCTTGTATTGGATGTCTCCAACAATAGTTTCTTCTGTTGTTTTCTTGGGATGTGCTCTATTGAAGAGTGCGCCGCTGA
ACGCAAGCACCATCTTCACGGTTTTAGCTACACTAAGAGTTATGTCAGAGCCTGTCAAAATTATACCTGATGCAATTTCT
GCTATCATCCAAGGCAATGTCTCGTTCCAAAGATTAAACAACTTTTTGCTTGACGACGAGCTAAAGATGGATGAAATCGA
AAGAAGTGGTCTGGATGCATCTGGAACAGCAGTTGACATACAAGTAGGTAACTTCGGTTGGGAACCAGAAACTAAGATTC
CAACTCTTCGGAATATACATCTGGAAATCAAGCATGGGCAAAAAGTTGCAGTTTGTGGACCAGTTGGAGCAGGAAAATCA
TCGCTGTTGCATGCAGTACTCGGAGAAATACCTAAAGTTTCTGGAACTGTAAAGGTCTTTGGGTCCATCGCTTATGTTTC
TCAGACTTCTTGGATCCAAAGTGGTACCATCCGGGACAATATCCTCTATGGAAAGCCCATGGAAAGTAGACGATACAATG
CTGCTATTAAAGCATGTGCGTTGGATAAGGACATGAACGGTTTTGGACATGGTGACCTCACAGAAATAGGACAAAGAGGG
ATTAACTTGAGCGGAGGACAAAAGCAAAGGATTCAGCTGGCCCGTGCTGTCTATGCAGACGCCGATGTTTACCTGCTTGA
TGATCCTTTTAGTGCTGTGGATGCACATACAGCTGGAGTTCTTTTTCATAAATGTGTTGAGGACTCGCTGAAGGAGAAAA
CTGTTATTCTGGTCACTCACCAAGTTGAGTTCCTCTCAGAAGTTGATCAAATTCTGGTTATGGAGGAAGGAACAATCACT
CAGTCAGGAAAATATGAGGAGCTCTTAATGATGGGGACTGCATTCCAACAGCTGGTAAATGCTCATAATGATGCAGTAAC
TGTATTACCTTTAGCGAGTAACGAAAGCCTCGGAGATCTTAGGAAAGAGGGCAAGGACAGAGAGATAAGAAACATGACGG
TTGTCGAAAAAATCGAAGAAGAGATCGAAAAAACGGATATTCCAGGGGTACAACTTACACAAGAAGAAGAAAAAGAGAGC
GGTTATGTTGGGATGAAACCTTTCTTGGACTATATCGGTGTCTCTCGAGGATGGTGTCTTCTATGGTCAAGCGTATTGGG
TCAGGTTGGCTTTGTAGTTTTTCAGGCTGCATCAACATACTGGCTGGCTTTTGCCATCGGGATCCCTAAAATCACGAATA
CAATGCTTATTGGAGTCTATAGCATTATATCAACTCTTAGTGCTGGTTTTGTATATGCGAGAGCTATTACGACTGCCCAT
CTTGGACTAAAAGCTTCCAAAGCCTTCTTCTCTGGTTTCACAAATGCAGTCTTCAAAGCCCCGATGCTTTTCTTTGATTC
TACTCCAGTTGGCCGCATTCTCACCCGAGCTTCGTCTGATTTGAACGTGTTGGACTATGACGTTCCATTTGCCTTCATAT
TTGTGGTAGCACCGGCTGTTGAGCTCACTGCAGCTCTTCTCATCATGACGTATGTCACATGGCAAGTAATTATCATAGCC
CTTCTTGCTTTGGCAGCCACGAAAGTTGTTCAGGATTACTATTTAGCCTCTGCAAGGGAGCTGATTAGGATCAATGGAAC
AACCAAAGCTCCAGTGATGAATTATGCTGCAGAAACCTCACTTGGGGTGGTGACAATTCGAGCTTTTGGAACCGCAGAGA
GATTCTTCAAAAACTACTTAAACCTAGTTGATGCAGATGCCGTGCTATTCTTTCTGTCTAATGCAGCCATGGAGTGGGTG
ATTTTGAGGATAGAGACTCTGCAGAATGTGACTTTGTTCACTTGTGCACTTCTTCTTATCCTTATTCCCAAGGGCTACAT
AGCTCCAGGCCTCGTTGGACTTTCGCTCTCCTATGCATTAACACTGACACAAACTCAGGTGTTTCTGACCCGATGGTATT
GTACTTTGTCGAATTCCATCATTTCAGTAGAGAGGATCAAACAATATATGAACATACCAGAAGAACCTCCTGCAATTATA
GATGATAAAAGACCACCTTCCTCATGGCCTTCCAATGGTACAATTCATTTGCAGGAGCTTAAGATAAGATATCGACCCAA
TGCTCCGTTGGTTCTCAAAGGAATCTCTTGCACATTCAGGGAAGGGACAAGAGTAGGAGTTGTCGGGAGGACGGGAAGCG
GAAAAAGCACATTGATCAGCGCATTGTTTCGCTTGGTAGAACCAGCAAGTGGTTGTATATTGATTGATGGGATTGACATA
AGTAAGATTGGCCTTAAAGACCTGAGAATGAAACTGAGCATCATTCCTCAAGAACCAACTCTTTTCCGTGGCTGCATAAG
GACAAACCTTGATCCTTTAGGTGTTTACTCCGACGATGAAATATGGAAGGCTCTAGAGAAGTGTCAGCTCAAGACAACGA
TTAGCAATCTTCCTAATAAACTTGATTCTTCAGTGAGTGATGAAGGAGAAAACTGGAGCGTGGGACAGAGACAACTGTTC
TGTCTTGGAAGAGTACTGTTAAAGAGAAACAAAATATTAGTGTTAGATGAAGCTACAGCTTCCATTGATTCAGCAACTGA
TGCAATCATTCAGAGAATTATAAGAGAAGAGTTTGCAGACTGTACAGTGATAACAGTTGCACATAGAGTACCAACTGTCA
TAGACAGTGACATGGTCATGGTTCTCTCTTTTGGTGATTTAGTAGAGTACAACGAGCCTTCGAAGCTAATGGAGACTGAT
TCTTACTTCTCTAAGCTTGTTGCTGAGTATTGGGCTAGTTGCAGAGGAAACTCTTCTCAGAATCTCCAATTATAA