Details for Arabidopsis Locus AT3G21230

Position : Chr3 ( 5`- 7448040 .. 7452000 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21230

Protein [Map View]
MVLQQQTHFLTKKIDQEDEEEEPSHDFIFRSKLPDIFIPNHLPLTDYVFQRFSGDGDGDSSTTCIIDGATGRILTYADVQ
TNMRRIAAGIHRLGIRHGDVVMLLLPNSPEFALSFLAVAYLGAVSTTANPFYTQPEIAKQAKASAAKMIITKKCLVDKLT
NLKNDGVLIVCLDDDGDNGVVSSSDDGCVSFTELTQADETELLKPKISPEDTVAMPYSSGTTGLPKGVMITHKGLVTSIA
QKVDGENPNLNFTANDVILCFLPMFHIYALDALMLSAMRTGAALLIVPRFELNLVMELIQRYKVTVVPVAPPVVLAFIKS
PETERYDLSSVRIMLSGAATLKKELEDAVRLKFPNAIFGQGYGMTESGTVAKSLAFAKNPFKTKSGACGTVIRNAEMKVV
DTETGISLPRNKSGEICVRGHQLMKGYLNDPEATARTIDKDGWLHTGDIGFVDDDDEIFIVDRLKELIKFKGYQVAPAEL
EALLISHPSIDDAAVVAMKDEVADEVPVAFVARSQGSQLTEDDVKSYVNKQVVHYKRIKMVFFIEVIPKAVSGKILRKDL
RAKLETMCSK*

DNA
ATGGTGCTCCAACAACAAACGCATTTTCTCACAAAGAAGATAGATCAAGAAGACGAAGAAGAAGAACCTTCTCATGATTT
CATTTTCCGATCTAAGCTTCCTGATATCTTCATCCCTAACCACCTCCCTCTCACCGATTACGTCTTCCAAAGGTTCTCCG
GCGATGGCGACGGAGATTCCTCAACAACCTGTATCATCGACGGTGCCACTGGCCGTATTTTGACCTACGCCGATGTACAA
ACCAACATGCGGAGGATAGCTGCCGGAATCCACCGGCTCGGGATCCGCCACGGAGACGTCGTAATGCTTCTCCTCCCGAA
CTCGCCGGAGTTTGCTCTGTCTTTTCTTGCCGTTGCTTACCTTGGAGCCGTTTCCACTACCGCGAATCCGTTCTACACTC
AGCCGGAGATCGCTAAACAGGCTAAAGCCTCCGCCGCGAAGATGATCATCACGAAGAAATGTTTAGTCGATAAACTAACA
AACCTCAAAAACGACGGCGTTTTGATCGTTTGCCTAGACGATGACGGTGACAACGGCGTTGTTTCGTCGAGTGATGATGG
TTGCGTGAGTTTCACGGAACTGACTCAAGCGGACGAAACAGAACTTCTAAAACCTAAAATATCGCCGGAAGACACGGTGG
CGATGCCGTACTCTTCCGGAACAACGGGACTTCCAAAGGGAGTGATGATTACTCACAAGGGTTTAGTTACAAGCATCGCT
CAGAAAGTCGACGGAGAAAACCCTAACCTTAACTTCACGGCCAATGACGTCATCCTCTGTTTTCTCCCAATGTTTCACAT
TTACGCTCTCGACGCGTTGATGCTTTCGGCGATGAGAACCGGTGCAGCGTTACTGATCGTGCCGAGGTTCGAGTTGAATC
TGGTGATGGAGCTGATTCAAAGGTACAAAGTCACGGTTGTGCCGGTGGCTCCTCCGGTGGTTTTAGCATTCATTAAATCC
CCTGAGACGGAGAGATACGACTTGAGCTCGGTGAGAATTATGCTATCAGGTGCAGCTACACTAAAGAAGGAGCTTGAAGA
CGCCGTGCGACTCAAGTTTCCTAATGCCATTTTTGGTCAGGGTTATGGAATGACCGAGTCCGGAACGGTAGCTAAGTCAT
TAGCGTTTGCAAAGAACCCATTTAAAACCAAGTCCGGTGCATGTGGGACTGTGATCAGAAACGCCGAGATGAAAGTGGTC
GATACCGAAACCGGAATCTCCTTGCCGCGCAACAAATCTGGCGAGATCTGCGTCCGAGGTCATCAGCTCATGAAAGGTTA
TTTGAATGATCCGGAAGCTACTGCACGAACCATAGACAAAGACGGGTGGTTACATACAGGAGATATTGGGTTTGTGGATG
ATGATGATGAGATCTTCATTGTTGATCGGTTGAAGGAACTGATCAAATTCAAAGGCTACCAAGTGGCTCCAGCTGAGCTT
GAAGCATTGCTTATTTCTCATCCTTCTATCGATGATGCCGCAGTTGTTGCAATGAAGGATGAAGTAGCTGATGAGGTTCC
AGTAGCATTTGTAGCAAGATCTCAAGGGTCTCAGTTAACTGAAGATGATGTCAAGAGTTACGTAAACAAACAGGTGGTTC
ACTACAAGCGGATTAAGATGGTGTTTTTCATAGAAGTTATACCAAAAGCAGTTTCGGGCAAGATTCTGAGGAAGGATCTG
CGAGCTAAATTGGAAACCATGTGCTCTAAATAG