Details for Arabidopsis Locus AT3G21220

Position : Chr3 ( 5`- 7445757 .. 7447351 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21220

Protein [Map View]
MKPIQSPSGVASPMKNRLRKRPDLSLPLPHRDVALAVPLPLPPPSSSSSAPASSSAISTNISAAKSLSELERVNRIGSGA
GGTVYKVIHTPTSRPFALKVIYGNHEDTVRRQICREIEILRSVDHPNVVKCHDMFDHNGEIQVLLEFMDQGSLEGAHIWQ
EQELADLSRQILSGLAYLHRRHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNH
GRYDGYAGDVWSLGVSILEFYLGRFPFAVSRQGDWASLMCAICMSQPPEAPATASQEFRHFVSCCLQSDPPKRWSAQQLL
QHPFILKATGGPNLRQMLPPPRPLPSAS*

DNA
ATGAAACCGATTCAATCTCCTTCTGGAGTAGCTTCACCTATGAAGAACCGTTTACGCAAACGTCCTGACCTAAGCTTACC
ACTCCCACACCGCGACGTCGCTCTCGCCGTACCTCTCCCTCTCCCACCTCCTTCTTCCTCTTCATCCGCTCCGGCGTCTT
CCTCCGCGATCTCAACCAACATCTCCGCCGCTAAAAGCTTATCCGAGCTAGAACGAGTGAACCGAATCGGAAGCGGAGCC
GGAGGAACGGTTTACAAAGTAATCCACACTCCGACGTCACGTCCTTTCGCTCTCAAAGTGATTTACGGAAACCACGAAGA
TACCGTGAGACGTCAGATCTGTAGAGAGATCGAGATCTTAAGAAGTGTTGATCATCCAAACGTTGTGAAATGTCACGATA
TGTTTGATCATAACGGTGAGATCCAGGTTTTGCTTGAGTTTATGGATCAAGGATCTCTTGAAGGAGCTCATATATGGCAA
GAACAGGAATTAGCTGATCTCTCTCGTCAGATTCTTAGTGGATTAGCTTATCTTCATCGTCGTCATATCGTTCATCGTGA
TATCAAACCTTCGAATCTTCTTATAAACTCAGCTAAAAATGTGAAAATTGCTGATTTTGGTGTGAGTAGGATCTTGGCAC
AAACAATGGATCCTTGTAATTCATCTGTTGGTACTATTGCTTATATGAGTCCTGAGAGGATTAATACTGATTTGAATCAT
GGTCGTTACGATGGTTATGCTGGAGATGTTTGGAGTTTAGGTGTTAGTATCTTGGAGTTTTACTTGGGGAGGTTTCCTTT
TGCTGTGAGTAGACAAGGTGATTGGGCTAGTCTTATGTGTGCTATTTGTATGTCTCAGCCACCTGAAGCTCCGGCTACGG
CGTCTCAGGAGTTTCGTCACTTTGTTTCTTGTTGTTTACAGAGTGATCCTCCTAAGAGATGGTCAGCTCAACAGCTTTTG
CAGCATCCTTTCATACTTAAAGCTACCGGTGGTCCTAATCTCCGTCAAATGTTGCCGCCGCCTCGTCCTCTTCCTTCTGC
CTCTTAG