Details for Arabidopsis Locus AT3G21215

Position : Chr3 ( 5`- 7441835 .. 7445303 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21215

Protein [Map View]
MAGAGIHPYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHPPPPPVLVDNHNRPPYDELRTIFIAGLPDDVKERELLNLLR
WLPGYEASQVNFKGEKPMGFALFSTAQFAMAAKDTLQHMVFDAESKSVIHTEMAKKNLFVKRGIVGDSNAYDQSKRLRTG
GDCTHSVYSPSPFHPPPPPVWGPPHGYMAPAPPPYDPYAGYHAPPVPMPTPPPIAAPSSYVPVQNIKDNPPCNTLFIGNL
GENINEEELRSLLSAQPGFKQMKILRQERHTVCFIEFEDVNSATNVHHNLQGAVIPSSGSIGMRIQYSKNPYGKRKEGGG
YSFFPSPSANGAQGALTYQ*

DNA
ATGGCCGGCGCCGGAATCCACCCATACCACCAGCAGTGGCCGCCGGCAGGTGCGCCGCCTCCTCCAGCCGCAGTATCATC
AGCTGCTCCACCACATCCGCCGCCCATTCATCACCATCCTCCTCCTCCTCCTGTTTTAGTTGACAACCATAATCGTCCTC
CTTATGACGAGCTGCGGACAATCTTCATCGCAGGGCTTCCCGATGATGTAAAAGAGAGAGAGCTTTTGAATCTCTTGAGA
TGGTTGCCTGGTTACGAGGCTTCTCAGGTGAACTTCAAGGGAGAAAAGCCCATGGGGTTTGCTCTTTTCTCCACAGCTCA
GTTTGCAATGGCAGCCAAAGATACCCTTCAGCATATGGTGTTTGATGCTGAGTCAAAGTCTGTGATACATACAGAGATGG
CCAAGAAGAATCTTTTTGTTAAAAGAGGTATTGTTGGGGATTCAAATGCTTATGATCAAAGTAAGCGCCTACGAACTGGT
GGTGACTGCACACACTCTGTGTATAGTCCATCTCCTTTCCATCCTCCACCTCCTCCTGTGTGGGGACCTCCTCATGGATA
TATGGCACCTGCACCTCCACCATATGATCCCTATGCAGGTTATCATGCTCCCCCTGTACCAATGCCTACGCCCCCACCTA
TAGCAGCTCCTAGTTCTTATGTGCCTGTCCAGAATATTAAGGATAATCCACCTTGCAATACCCTATTTATTGGTAATCTT
GGGGAGAATATAAACGAAGAAGAATTGAGGAGCCTGTTGAGTGCGCAACCTGGTTTCAAACAAATGAAGATTCTGAGACA
AGAAAGGCATACAGTTTGCTTTATTGAATTCGAGGATGTCAATAGTGCCACAAATGTTCACCATAATTTGCAAGGTGCTG
TCATTCCAAGTTCTGGTTCAATTGGCATGAGGATCCAATATTCAAAGAATCCATATGGGAAGAGAAAGGAAGGTGGCGGC
TATTCTTTCTTTCCTTCTCCGAGTGCTAATGGAGCCCAAGGAGCCCTGACATATCAGTAG