Details for Arabidopsis Locus AT3G21210

Position : Chr3 ( 5`- 7437964 .. 7440826 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21210

Protein [Map View]
MMNPESDHPSSPRQRKIGIAVELSEESAFTVRWAVDNYIRQGDDIIILHVSPTAGLFGADWGYYPLQTQPPYTTASIFSK
VADLGKPLKEAGFPHTIHTVKDYDKRERLCLETQRLNLTALIMGFGDGSVSDFCVHHCVCQVVVVRYPDGPGSVEGTRAA
PIVTFKSRTDDDEEIDKAKTALTASVHHQHIKAMDSVSKQPLLFCPRAYFTNNEEDFRAMQFREPPNLSSPSFHLTSLVL
GNDFNITRKYYYDRHGKGFIKGHRPNKQCEICSKSLLGTTFYSCTLCLRPSCSPLQSSVLSRSSGYYHEACIEPISKHPY
HPKHALRFRYESGQICLSCSTFKDFAYHCSICNFTMCQDCAREPPLFAIDYPKRHEHTLFYFQRKGSLICDVCGLSDGRS
LLYSCVKCNFVVHKECVYFPCIIKISRHEHRLSFNSSLTPEQWLCGVCRESIDTNFARYSCVKGCSFAVHSKCATRKDVW
DGKELEGEPEEDESLYIFKSFNEISDGIIEYFRHKSHHMRLDEDTNRAFDEDKRCRACTFPICDDLIYSCMQCDFILHQT
CAHLPPRKQHATHPHPLLLLVDEEHEDYFQCTACKRESNGFAYTCCARDCNFTLDVSCASIAESLIHRFHPHPIYLIHES
TAQEFCSICGQLIGHRLNCGECRFALCFGCATLPNKLRYKHDEHFLIFSYDEDFSGSQESGPHLCEVCEKQANPKNGVYM
CNDCNVTLHVECLLGKEMYMMPIGGLISRNVNVDILPNNRLTRNICQRCHNRCQGKIIFKARDRSTFLCSLFCCLTKSWV
DRDT*

DNA
ATGATGAATCCAGAATCCGATCATCCTTCATCTCCTCGTCAACGTAAGATTGGAATCGCCGTGGAGCTCTCTGAAGAAAG
TGCCTTCACTGTTCGTTGGGCTGTTGATAACTACATCCGTCAGGGAGACGACATCATTATTCTACACGTCTCTCCAACCG
CCGGTCTCTTTGGAGCCGATTGGGGATATTACCCTCTCCAAACTCAACCTCCTTACACCACCGCTTCTATTTTCTCCAAA
GTAGCGGATCTCGGGAAGCCATTGAAGGAAGCTGGATTCCCTCACACGATTCATACAGTCAAAGATTACGATAAGAGAGA
GAGGCTTTGTCTTGAGACTCAACGGCTCAATCTCACTGCTCTGATTATGGGATTTGGTGATGGCTCTGTTAGTGATTTCT
GTGTTCACCACTGTGTTTGTCAAGTCGTTGTGGTTAGATACCCTGATGGTCCTGGCAGTGTTGAAGGTACTCGGGCAGCG
CCTATTGTAACTTTCAAATCACGTACGGATGATGACGAAGAGATAGATAAGGCTAAGACTGCTCTGACTGCTTCTGTTCA
TCATCAACACATCAAAGCCATGGATTCGGTGTCAAAGCAGCCTCTTCTCTTTTGCCCTCGTGCATATTTTACTAACAATG
AAGAAGATTTTCGCGCGATGCAATTCCGAGAGCCACCAAATCTTTCATCTCCATCTTTTCACCTCACCTCCTTAGTTTTG
GGCAACGACTTTAACATAACACGCAAATACTACTACGACAGACATGGCAAGGGCTTCATTAAAGGCCATAGACCTAACAA
ACAATGTGAAATATGCTCCAAGTCATTACTCGGTACCACGTTTTATTCCTGCACGTTATGTCTCCGTCCTTCATGTTCCC
CTCTTCAATCTTCAGTATTATCACGCTCTTCAGGCTACTACCACGAAGCCTGTATCGAGCCGATATCAAAGCACCCATAT
CATCCTAAACATGCTCTCCGATTTCGTTATGAATCAGGTCAGATATGCTTATCTTGTTCAACTTTTAAGGATTTTGCTTA
CCATTGCTCTATATGCAATTTTACCATGTGTCAAGATTGTGCTAGAGAGCCACCACTCTTTGCAATAGACTATCCAAAAA
GGCATGAGCATACACTCTTCTACTTTCAAAGGAAAGGCTCCTTGATTTGTGACGTTTGTGGGTTGAGTGATGGCAGGTCT
TTGCTGTATTCCTGTGTCAAGTGTAATTTTGTAGTCCATAAAGAGTGTGTCTATTTTCCATGCATCATAAAAATATCACG
TCATGAACATCGTCTCTCCTTCAATTCTTCACTTACTCCTGAACAATGGTTATGTGGAGTGTGTCGTGAAAGCATAGACA
CAAATTTTGCAAGATATTCTTGCGTAAAGGGTTGCAGTTTCGCGGTTCATTCTAAATGTGCAACGCGAAAAGATGTATGG
GACGGAAAAGAACTTGAGGGAGAACCAGAAGAAGATGAATCTCTATATATTTTTAAGTCGTTCAATGAGATAAGTGATGG
AATTATAGAATATTTTCGTCACAAAAGTCATCATATGAGACTGGACGAGGATACCAACAGAGCATTTGACGAGGATAAAC
GTTGTCGAGCATGCACGTTTCCTATCTGTGATGATCTTATTTACAGTTGCATGCAATGTGATTTTATCCTCCATCAAACA
TGTGCACATCTTCCTCCGAGGAAACAACATGCGACACATCCTCATCCCCTTCTTCTACTGGTGGATGAGGAACATGAAGA
TTATTTTCAATGCACTGCTTGTAAGCGTGAAAGCAATGGTTTTGCGTACACATGTTGTGCTAGGGATTGCAACTTCACAT
TAGACGTATCTTGCGCTTCTATAGCTGAGTCATTGATTCATCGGTTTCATCCGCATCCTATTTATTTAATACATGAATCC
ACAGCGCAAGAGTTCTGTTCGATTTGCGGACAACTCATAGGTCATCGTCTAAACTGTGGAGAATGTCGTTTTGCTTTGTG
TTTTGGGTGCGCCACTTTACCCAATAAGTTGAGGTATAAGCATGATGAACATTTTCTCATATTTTCTTATGATGAAGACT
TCAGTGGTTCACAAGAAAGTGGTCCGCATTTGTGTGAAGTTTGTGAAAAACAAGCAAATCCGAAGAATGGAGTTTATATG
TGCAATGATTGTAACGTCACACTGCATGTTGAATGTCTTCTTGGAAAGGAGATGTATATGATGCCTATTGGAGGGCTCAT
TTCCCGTAACGTAAATGTTGATATTCTTCCCAATAATCGTCTCACTCGCAACATATGCCAACGTTGCCATAATCGTTGTC
AAGGAAAAATAATCTTCAAAGCACGTGACAGATCAACATTTTTATGTTCTTTGTTTTGTTGTCTGACGAAGAGTTGGGTG
GACAGAGACACATAG