Details for Arabidopsis Locus AT3G21190

Position : Chr3 ( 5`- 7432299 .. 7434665 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21190

Protein [Map View]
MGVDLRQVVAGILTITMFVMLGQMLHRDYFDSLQEKAQGDAQDIEFEGSKVSVKDGLVGTVEGSKGLWMEDNTDLTPCWP
TLLSDDAVSSKGYVTFSLTNGPEYHISQITDAVMVAKHLGATLVLPDIRGSKPGDERNFEDIYDADKLIKSLENVVKVVK
KLPEEVSLRNMAIVKVPTRVTEDYIKEHIDPIFKSKGNIRVASYFPSVNLRKSSQDGETDPVACLAMFGSLELQPEVNAV
AESMVERLRTHSRKSGGRFIAVDLRIDILEKKNCHTTGVVGSKTCYNAQEIALFLRKLGFASDTTIYLTQPRWDSSLNIL
KDIFPKTFTKEAIMPASKRSKYLESVSSEYENVIDFYISSRSDVFVPAISGLFYANTVGKRIALGKPQVLVPAEISETSG
LATDFISPYISKKNHLAYSCFC*

DNA
ATGGGTGTTGATTTGAGGCAAGTAGTTGCTGGTATTCTCACCATTACCATGTTTGTGATGCTTGGACAGATGCTTCATAG
AGATTACTTTGATTCTCTTCAGGAGAAAGCTCAGGGAGATGCACAAGATATTGAATTTGAAGGATCTAAAGTCTCTGTGA
AAGATGGTCTTGTCGGAACCGTTGAAGGCAGTAAAGGACTTTGGATGGAAGATAACACTGATCTTACTCCTTGTTGGCCA
ACATTACTATCTGATGACGCTGTATCATCGAAAGGGTATGTTACATTCTCACTTACCAATGGTCCTGAGTACCATATCTC
TCAGATCACTGATGCTGTAATGGTGGCTAAGCATCTTGGAGCAACTCTAGTACTTCCTGATATAAGAGGAAGCAAACCTG
GTGATGAAAGGAATTTTGAAGATATCTATGATGCGGATAAGCTGATTAAAAGCTTGGAAAATGTCGTTAAAGTTGTGAAA
AAATTGCCTGAAGAAGTTTCTCTAAGGAACATGGCCATTGTGAAGGTCCCTACCAGAGTTACAGAAGATTACATTAAAGA
GCACATTGATCCCATCTTTAAATCTAAAGGAAACATTCGAGTTGCATCATACTTCCCTTCTGTAAACTTGAGAAAATCCT
CACAAGATGGCGAAACTGATCCTGTAGCCTGTTTAGCAATGTTTGGGTCTTTGGAGTTGCAACCTGAAGTGAATGCAGTG
GCTGAATCAATGGTTGAGCGGTTGAGGACTCATAGCCGTAAATCCGGTGGCCGTTTCATAGCAGTAGACCTTAGAATCGA
CATACTTGAGAAGAAAAATTGCCATACAACTGGTGTAGTAGGGTCCAAGACATGTTACAACGCTCAAGAGATTGCTTTAT
TCTTGAGAAAGCTTGGATTTGCCAGCGACACAACTATCTATCTGACTCAGCCAAGATGGGACAGTAGCCTCAATATCCTT
AAGGATATCTTCCCAAAAACATTCACTAAGGAGGCAATAATGCCGGCAAGTAAGAGATCAAAGTACCTTGAATCAGTGAG
TTCCGAGTACGAAAATGTTATCGACTTCTACATAAGCTCAAGAAGCGATGTCTTTGTTCCAGCCATCTCCGGTCTGTTTT
ATGCAAACACCGTTGGCAAAAGGATAGCTTTAGGTAAGCCTCAAGTGTTAGTTCCAGCAGAAATCTCAGAGACATCTGGC
CTTGCTACAGATTTCATCTCTCCATACATCTCAAAGAAGAACCATTTGGCTTATTCATGCTTTTGCTGA