Details for Arabidopsis Locus AT3G21175

Position : Chr3 ( 5`- 7422036 .. 7424905 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21175

Protein [Map View]
MDDLHGRNGRMHIGVAQNPMHVQYEDHGLHHIDNENSMMDDHADGGMDEGVETDIPSHPGNSADNRGEVVDRGIENGDQL
TLSFQGQVYVFDRVSPEKVQAVLLLLGGREVPHTLPTTLGSPHQNNRVLGLSGTPQRLSVPQRLASLLRFREKRKGRNFD
KTIRYTVRKEVALRMQRKKGQFTSAKSSNDDSGSTGSDWGSNQSWAVEGTETQKPEVLCRHCGTSEKSTPMMRRGPDGPR
TLCNACGLMWANKGTLRDLSKVPPPQTPQHLSLNKNEDANLEADQMMEVTGDISNTQ*

DNA
ATGGATGATCTTCATGGAAGAAATGGTCGAATGCACATTGGTGTAGCGCAAAATCCAATGCATGTGCAGTATGAAGATCA
CGGTTTGCACCATATCGACAATGAAAACAGTATGATGGATGACCATGCTGATGGTGGGATGGATGAAGGAGTGGAGACAG
ACATTCCTTCTCACCCTGGAAACTCAGCTGATAATCGTGGTGAAGTTGTAGACCGTGGAATTGAAAATGGAGATCAATTG
ACATTGTCCTTCCAGGGACAAGTTTATGTTTTTGACCGTGTCTCGCCTGAGAAGGTTCAAGCTGTGCTTTTGTTACTTGG
TGGAAGGGAAGTACCACATACACTCCCAACAACCCTAGGATCACCTCATCAGAACAATAGGGTACTGGGTCTATCTGGTA
CTCCTCAACGGCTTAGCGTTCCGCAGCGGTTAGCTTCTTTGCTCAGGTTTAGGGAGAAACGAAAAGGGAGGAACTTTGAT
AAGACTATTCGCTATACAGTCAGGAAAGAAGTAGCCTTGAGAATGCAGCGTAAGAAAGGTCAGTTCACGTCGGCTAAATC
AAGCAATGATGATTCTGGATCCACTGGATCGGATTGGGGGTCAAACCAGAGCTGGGCCGTAGAAGGGACTGAGACTCAGA
AGCCAGAGGTTTTATGTCGACACTGTGGAACAAGTGAGAAGTCAACTCCAATGATGCGACGTGGACCTGATGGGCCAAGA
ACACTTTGTAATGCGTGTGGACTGATGTGGGCAAACAAGGGGACTCTTAGAGACCTATCCAAAGTCCCTCCTCCGCAAAC
ACCTCAGCATCTATCTCTGAATAAGAATGAGGACGCAAATCTTGAGGCTGATCAAATGATGGAAGTAACTGGTGACATTA
GCAACACACAGTGA