Details for Arabidopsis Locus AT3G21160

Position : Chr3 ( 5`- 7413847 .. 7418410 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21160

Protein [Map View]
MARNKLVSGSHGIWKYFNPAFYLRRPRRLALLIILFVSVSMVVWDRQSLSRDYQFEVSKLNEEVLRLQQMLEEIKSVTED
VSVNSLKDVQEDPVDAQRMQRVKEAMVHAWSSYEKYAWGQDELQPQTKDGVDSFGGLGATMIDALDTLYIMGLDEQFQKA
REWVASSLDFDKDYAASMFETTIRVVGGLLSAYDLSGDKIFLEKAMDIADRLLPAWDTQSGIPYNIINLKHGNAHNPTWA
GGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVISVLNKNFPADGLLPIYINPDTANPSQSTITFGAMGDSFYEYLLK
VWVFGNKTSAVKHYRDMWEKSMNGLLSLVKKSTPLSFTYICEKSGNSLIDKMDELACFAPGMLALGASGYSDPAEGKKFL
TLAEELAWTCYNFYQSTPTKLAGENYFFNSGSDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNIFEAFEKNSRI
ESGYVGLKDVNTGVKDNKMQSFFLAETLKYLYLLFSPTTVIPLDEWVFNTEAHPLKIKSRNDQVNLKQSNKVLLRKPAFR
IRQRHYGRITKK*

DNA
ATGGCGAGGAATAAACTTGTAAGTGGTAGTCATGGGATATGGAAATATTTCAACCCAGCGTTTTATCTCCGAAGACCAAG
ACGTCTTGCTTTGCTCATCATCCTCTTCGTCTCTGTTTCAATGGTTGTTTGGGATCGTCAATCTCTTTCCCGAGACTACC
AGTTTGAAGTTTCCAAGTTAAATGAAGAAGTTTTGCGGTTGCAGCAGATGTTGGAAGAGATAAAGAGCGTCACTGAGGAT
GTGTCTGTCAATAGTTTGAAGGATGTTCAGGAAGATCCAGTTGATGCTCAGCGAATGCAGAGAGTTAAAGAGGCAATGGT
TCATGCTTGGAGTTCATATGAAAAGTATGCCTGGGGACAAGATGAGCTTCAGCCCCAGACAAAGGATGGTGTTGACAGCT
TTGGTGGCCTGGGTGCAACTATGATAGATGCATTAGACACACTATATATAATGGGTCTAGATGAGCAGTTTCAGAAAGCC
AGAGAGTGGGTAGCAAGCTCATTAGATTTCGACAAGGATTATGCTGCCAGTATGTTTGAGACAACCATAAGAGTGGTAGG
AGGGCTTCTCAGTGCGTATGATCTTTCTGGGGATAAAATTTTCCTTGAAAAGGCTATGGATATTGCAGACAGATTATTGC
CTGCATGGGACACTCAATCGGGTATACCATATAATATTATCAACTTGAAGCATGGAAATGCTCACAATCCTACATGGGCG
GGGGGAGACAGTATTCTTGCAGATTCTGGTACTGAGCAGCTTGAATTTATTGCCCTTTCCCAGAGGACAGGGGACCCAAA
ATATCAGCAAAAGGTAGAAAAGGTTATTTCAGTGCTAAATAAGAACTTCCCTGCTGATGGTTTACTTCCGATATATATAA
ATCCCGATACAGCTAATCCATCGCAGTCTACAATAACATTTGGTGCCATGGGAGACAGCTTTTACGAATATTTGCTCAAA
GTTTGGGTGTTTGGGAACAAAACTTCAGCAGTGAAACACTATAGAGATATGTGGGAGAAGTCAATGAATGGTCTGCTAAG
CTTGGTTAAGAAATCAACACCTTTGTCGTTTACATATATCTGTGAGAAGAGTGGAAATTCTTTGATCGATAAGATGGATG
AATTGGCATGCTTTGCTCCTGGAATGTTGGCTTTAGGAGCATCTGGGTATAGTGATCCTGCTGAAGGAAAGAAGTTTCTC
ACACTCGCTGAAGAGCTTGCGTGGACATGTTATAACTTTTACCAATCAACTCCAACAAAACTGGCTGGGGAGAATTATTT
CTTCAACTCTGGGAGTGACATGAGTGTTGGAACGTCGTGGAACATCTTGAGACCAGAAACTGTCGAATCACTGTTTTACC
TCTGGCGGTTAACTGGAAACAAGACATATCAAGAGTGGGGATGGAATATATTTGAAGCATTTGAGAAGAACTCGCGCATA
GAGTCTGGATATGTTGGTTTGAAGGATGTTAATACAGGCGTTAAGGACAACAAGATGCAAAGTTTCTTCCTTGCAGAGAC
ACTCAAGTATCTCTATCTACTCTTCTCGCCGACAACAGTCATTCCTTTAGACGAGTGGGTATTCAACACCGAAGCTCATC
CACTTAAGATTAAGTCTCGAAACGATCAGGTAAATCTCAAACAATCCAACAAAGTACTGCTACGAAAACCGGCATTTAGA
ATACGCCAGAGGCATTATGGTCGGATAACAAAGAAGTAA