Details for Arabidopsis Locus AT3G21130

Position : Chr3 ( 5`- 7408246 .. 7409349 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21130

Protein [Map View]
MMKKRNTVYLSEDLIVEILSRVSAVSLARLRTTSKRWNALVKDERLAKKHSAYAPRQSLVITLIDSRVYLMNVSLQYGIE
KVDLSAKLTGQFSLKDPLSNSLEEVDIRNVFHCDGLLLCSTKDNRLVVWNPCSGETRWIQPRSSYKVSDIYALGYDNTSS
CHKILRMDRSEDRIPIQTEYQVYDFTSKSWLVDGVAGGLFIPSIGTRRRGLSVKGNTYWLALTEDGPPFDMFLLCFDFST
DGFRRLSLPTDTPCTYYDVSLSVTREEQQLCMFKSHGSELWIATKMESTGAISWSKSHRFHFRIDEMTVLADQEKPVFVY
RFKPKSNMLHIVGEHIYIIQVDQHSADSKCPYLLTYVPSLVQIQQSI*

DNA
ATGATGAAGAAGAGAAACACAGTTTATCTTTCGGAGGATTTGATAGTGGAGATACTCTCTAGAGTTTCGGCTGTATCTTT
GGCACGATTACGAACTACATCCAAACGATGGAACGCTCTTGTTAAGGACGAGAGACTTGCTAAGAAGCACTCTGCTTATG
CTCCAAGGCAGTCTCTGGTTATCACGTTGATTGATTCCAGGGTTTATTTAATGAACGTGAGTCTCCAATATGGAATTGAA
AAGGTTGATCTATCTGCAAAGCTAACAGGTCAATTCAGCCTAAAAGATCCTCTTTCAAATTCTTTAGAGGAAGTTGATAT
ACGTAACGTCTTTCACTGCGACGGCTTATTACTATGCAGCACCAAAGACAATAGATTAGTTGTTTGGAATCCATGTTCAG
GTGAAACAAGGTGGATCCAACCTAGAAGTTCCTACAAGGTATCAGACATCTATGCTTTAGGTTATGATAACACATCCTCA
TGTCACAAAATCTTGAGGATGGATCGATCTGAGGACCGTATCCCAATTCAAACTGAGTACCAAGTCTATGACTTTACCTC
TAAATCGTGGCTAGTTGATGGTGTGGCTGGAGGCTTGTTCATACCAAGTATTGGGACTCGGAGACGTGGCTTGTCTGTGA
AGGGAAATACTTACTGGCTTGCTCTTACTGAAGACGGACCGCCATTTGATATGTTCTTATTATGTTTTGATTTTTCGACT
GACGGATTTCGACGTCTGTCTCTTCCGACGGATACTCCTTGTACTTATTATGATGTGTCTTTATCAGTGACTAGAGAAGA
GCAACAACTTTGTATGTTTAAGAGTCATGGCTCTGAGTTATGGATAGCAACTAAGATGGAGAGTACCGGAGCCATTTCAT
GGAGCAAGTCCCATCGTTTTCACTTTAGAATTGATGAGATGACTGTCTTGGCTGACCAAGAGAAGCCCGTTTTCGTGTAT
CGCTTCAAACCCAAGTCCAACATGTTACACATTGTGGGAGAGCATATATACATCATACAAGTGGATCAGCATAGTGCAGA
TTCTAAATGTCCATATCTCCTTACTTATGTTCCAAGTTTGGTTCAAATCCAACAAAGTATCTAA