Details for Arabidopsis Locus AT3G21110

Position : Chr3 ( 5`- 7402481 .. 7405641 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21110

Protein [Map View]
MAQCVRSTLNPVRTPQSFTRKAYVKSPAFASVSFLRAVPEFNKYPKPCSLVMSCQGKAQNQQEERPQLSLDDLVTSNRKG
EVLGTIKDSLSNCLSETNLLATVPGLKSRIKGKVRDIYDAGDYLVLITTDRLSAFDRNLASIPFKGQVLNETSLWWFNNT
QHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYNKGVRNYCGNELSDGLVKNQKLPANILTPTTKA
ADHDVPISPNEIVEGGFMTQAEFDEASMKALSLFEFGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLA
GSYEERFQKGLEPENVDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDIIPTQEPIHDRISRN
TSQALSSLRQL*

DNA
ATGGCTCAGTGTGTGAGGTCAACTCTAAATCCTGTGAGAACACCCCAGAGCTTTACTAGGAAAGCGTATGTGAAAAGCCC
AGCTTTTGCATCAGTCTCGTTCCTTCGAGCAGTACCGGAGTTCAACAAATACCCAAAACCTTGTTCATTGGTTATGTCTT
GCCAGGGCAAGGCTCAAAACCAGCAGGAGGAGCGACCACAACTGTCTCTTGACGATTTAGTCACGAGTAACCGGAAAGGG
GAGGTTCTTGGCACAATCAAAGACTCGCTTTCTAATTGTCTCTCTGAGACTAATCTTCTTGCCACTGTTCCTGGTCTGAA
ATCTAGAATCAAGGGAAAGGTCAGAGATATTTATGATGCTGGTGATTATCTGGTTCTTATTACAACTGATCGGTTGAGTG
CATTCGACAGAAACCTTGCTTCAATTCCCTTCAAAGGCCAGGTTCTTAATGAGACAAGTTTGTGGTGGTTCAATAACACA
CAGCACATAACTCCAAATGCAATCGTTTCATCTCCTGATAGAAATGTTGTTATCGCAAAGAAATGCTCGGTTTTTCCCAT
AGAGTTTGTGGTTAGAGGATATGTGACTGGAAGTACTGACACATCTTTATGGACGGTGTACAATAAAGGTGTTCGGAACT
ACTGTGGGAATGAGCTCTCAGATGGATTAGTTAAAAACCAGAAGCTTCCAGCTAATATACTTACACCAACAACTAAGGCT
GCGGATCATGATGTGCCCATCTCTCCAAATGAGATAGTTGAAGGTGGATTCATGACTCAAGCTGAATTTGATGAAGCAAG
TATGAAAGCTTTGAGCTTGTTTGAGTTTGGGCAGGGGGTGGCCAAGAAACATGGACTGATATTGGTGGACACAAAGTATG
AGTTTGGAAGAAGTAGTGATGGCTCAATCTTATTGATTGATGAGATTCATACACCCGATTCCAGCAGATACTGGCTTGCG
GGTTCATATGAAGAGCGCTTCCAAAAAGGCCTGGAGCCTGAAAATGTTGATAAGGAGTTCCTAAGATTGTGGTTCAAAGA
GAACTGCAATCCGTATGAGGACGAGGTCCTGCCTGCTGCTCCAGCAGAACTCGTGACTGAATTAGCTTGGCGGTACATTT
TCTTGTATGAAACTATCACTGGATCAAGAATTGACATTATTCCGACTCAGGAACCAATACATGACCGAATCTCAAGGAAC
ACAAGCCAAGCACTTTCATCTCTCCGTCAACTTTGA