Details for Arabidopsis Locus AT3G21080

Position : Chr3 ( 5`- 7388367 .. 7389974 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21080

Protein [Map View]
MATHDFDFTDPYGNKDRKSLYSNQDNYFNNWSSLTQSEEVVEELSIQQTKYDHRSLPSLRTAEAEAAEWNELERWGNQEL
QHNGTRIRGIITYKSGNLPGVLSFSVIEILMMVVASFVPNFLTGLFTGAGLIGIIMTSSGFSRLLPDLPKIFCRFSISYT
ISYMIFGSWAIKLGHNNNFLGPLSPDEPKMTGEEMNMNEFGVKVTHSGWWGFPEIVIAILVCTWLLFFVAQKLKERARPA
SRVIQAKVYFNVQLS*

DNA
ATGGCGACACACGACTTCGATTTCACTGATCCCTATGGAAATAAAGATAGAAAAAGTTTGTACTCAAACCAAGATAACTA
TTTCAATAATTGGTCTTCACTTACTCAATCAGAGGAAGTTGTTGAGGAGCTTTCTATTCAACAGACTAAATACGACCATC
GGAGTCTGCCTTCTTTGAGAACTGCCGAAGCCGAGGCTGCTGAGTGGAATGAGTTGGAGAGATGGGGGAACCAAGAGTTG
CAGCATAATGGCACTCGCATTAGAGGAATTATAACTTACAAATCAGGGAACTTGCCCGGTGTTTTGTCATTCTCTGTAAT
AGAGATTCTCATGATGGTTGTGGCTTCGTTTGTTCCAAACTTCTTGACTGGTCTTTTCACTGGAGCTGGCCTTATTGGAA
TCATCATGACGTCTTCTGGATTCTCCCGTCTTCTTCCTGATCTTCCCAAAATCTTTTGCCGTTTCTCGATTTCCTACACG
ATTTCTTACATGATTTTTGGATCTTGGGCCATCAAGCTAGGGCACAACAACAATTTTCTCGGGCCTCTATCACCGGACGA
GCCGAAAATGACAGGAGAAGAAATGAATATGAATGAATTTGGAGTAAAGGTGACGCATTCAGGATGGTGGGGCTTCCCTG
AGATTGTGATAGCAATCCTTGTGTGTACCTGGCTTCTTTTCTTCGTGGCCCAAAAGCTGAAGGAGAGAGCACGACCAGCT
TCAAGGGTGATTCAGGCGAAAGTTTATTTTAATGTGCAGCTTTCATAA