Details for Arabidopsis Locus AT3G21055

Position : Chr3 ( 5`- 7376635 .. 7377186 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G21055

Protein [Map View]
MASMTMTATFFPAVAKVPSATGGRRLSVVRASTSDNTPSLEVKEQSSTTMRRDLMFTAAAAAVCSLAKVAMAEEEEPKRG
TEAAKKKYAQVCVTMPTAKICRY*

DNA
ATGGCATCGATGACCATGACCGCTACCTTCTTCCCGGCCGTCGCCAAGGTTCCCTCAGCCACCGGCGGACGAAGGCTCTC
CGTAGTCAGAGCCTCCACGAGCGACAACACACCCAGCTTAGAAGTCAAGGAACAGAGCAGCACCACAATGAGGAGGGACC
TCATGTTCACGGCTGCAGCTGCAGCGGTTTGTTCTTTGGCTAAGGTAGCCATGGCTGAAGAAGAAGAGCCCAAGCGAGGG
ACAGAGGCGGCCAAGAAGAAATACGCACAAGTTTGTGTCACAATGCCTACGGCCAAGATCTGCCGCTACTGA