Details for Arabidopsis Locus AT3G20920

Position : Chr3 ( 5`- 7328576 .. 7330751 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20920

Protein [Map View]
MKKPVGAEKKRVKRSSGSASTSVRDSGSDSQPRKQAVKKDSFQLFAEKVRDHKGLESRWAVMEQARVEYFRGKDFVSFMK
NNPDFKDILEEDKDLDTDDIANVLLGKNLLVRCDRVTKTLRPGKKKLSTWPAHLEIFRDDQSFSENDAFFAWTFEKRHPL
WQTLLSFFWPVLTLAICLFPVYPHRCKLIVLYSCAGILLMILSLLFVRAVAFGAMWILLGKRVWFFPNILAEEATLKELF
RFWPKKDEEEPPKWTSRLFYTVVAIVVVMLLRRHAPDEAARARYQRRMSNIIDDVLEWSPKLALSGLMENQQPVNITDAA
NNSSDSAGGPDQTEEVDLDETQGEDLDETQGKEEAEGWTDSDLKT*

DNA
ATGAAGAAGCCGGTCGGAGCCGAGAAGAAGAGGGTTAAACGATCATCGGGATCTGCATCTACTTCCGTTAGAGATTCTGG
TTCTGATTCTCAACCTAGGAAGCAAGCTGTGAAGAAGGATAGTTTTCAGTTGTTTGCTGAGAAAGTTAGAGACCACAAGG
GATTAGAATCCAGATGGGCTGTTATGGAGCAAGCACGAGTTGAATACTTTAGAGGGAAAGATTTTGTGAGCTTTATGAAG
AATAACCCTGACTTTAAAGATATTCTGGAAGAAGATAAAGACCTTGACACAGACGATATTGCCAATGTTTTGTTGGGAAA
GAACCTTTTGGTCCGCTGTGATCGTGTTACTAAAACTCTTCGTCCCGGGAAGAAAAAGCTCTCTACTTGGCCTGCTCATT
TGGAGATTTTCCGTGACGATCAATCTTTCTCTGAAAATGATGCCTTTTTTGCATGGACGTTCGAAAAACGGCATCCGCTA
TGGCAAACGCTTTTGTCCTTCTTCTGGCCTGTATTGACTCTTGCAATTTGTTTGTTTCCTGTGTATCCACACCGTTGCAA
ACTAATTGTACTCTACTCATGTGCGGGCATTCTTCTGATGATTCTCTCCTTACTTTTCGTGAGAGCAGTTGCTTTCGGTG
CTATGTGGATTCTTTTGGGAAAGCGTGTCTGGTTCTTCCCCAACATTCTAGCTGAGGAAGCCACATTGAAGGAACTGTTC
CGTTTCTGGCCAAAGAAAGACGAGGAAGAACCGCCCAAGTGGACATCTCGACTTTTCTACACAGTAGTGGCTATTGTTGT
TGTCATGCTGCTTAGGCGTCATGCCCCTGATGAAGCTGCTCGGGCCAGGTACCAAAGAAGGATGTCCAACATCATTGATG
ATGTCCTTGAGTGGTCACCAAAGCTAGCACTTTCTGGTTTGATGGAGAATCAGCAACCTGTAAACATCACAGATGCGGCA
AACAACTCCTCAGATTCAGCAGGAGGTCCCGACCAGACTGAAGAGGTCGACCTAGATGAAACTCAAGGCGAGGACCTAGA
CGAAACGCAAGGCAAGGAGGAAGCTGAAGGTTGGACTGACTCTGATCTTAAAACATAA