Details for Arabidopsis Locus AT3G20890

Position : Chr3 ( 5`- 7319848 .. 7321054 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20890

Protein [Map View]
MFYRGYGDGPDGREMGPKRQRMIDQGPPGPFYGPHPSSGFMYNPYGFVAPPPPPPFPAVRLRGLPFDCAELDVVEFFHGL
DVVDVLFVHRNNKVTGEAFCVLGYPLQVDFALQKNRQNMGRRYVEVFRSTKQEYYKAIANEVAESRVHGMASGGGGGLGG
GNGSGGGGGGGGGGGRISGGSSPRRHVQRARSSDDGKEDIEHTGILRLRGLPFSAGKEDILDFFKDFELSEDFVHVTVNG
EGRPTGEAFVEFRNAEDSRAAMVKDRKTLGSRYIELFPSSVEELEEALSRGR*

DNA
ATGTTCTACAGAGGATATGGAGATGGTCCTGATGGGCGTGAGATGGGACCTAAGCGTCAAAGAATGATTGATCAAGGTCC
TCCAGGACCATTCTATGGACCTCATCCTAGTTCTGGCTTTATGTATAACCCTTATGGATTTGTTGCTCCTCCTCCACCTC
CTCCTTTTCCTGCGGTTCGACTCCGTGGTTTACCCTTTGATTGCGCAGAGCTTGATGTAGTAGAGTTTTTTCATGGTTTG
GATGTGGTTGATGTCTTGTTTGTTCACAGGAACAATAAGGTTACTGGAGAAGCCTTTTGCGTTTTGGGTTATCCCCTTCA
GGTTGATTTTGCTCTTCAGAAGAATAGACAGAACATGGGAAGGAGATATGTAGAAGTTTTTAGGAGTACAAAACAGGAGT
ACTATAAGGCTATTGCTAACGAGGTTGCGGAATCTCGTGTCCATGGTATGGCTAGTGGTGGTGGTGGAGGTTTAGGTGGT
GGCAATGGAAGTGGAGGTGGAGGTGGAGGTGGTGGCGGTGGAGGTCGAATAAGTGGTGGAAGTTCACCTCGCAGACACGT
GCAGAGGGCTAGATCGAGTGATGATGGGAAAGAGGATATTGAACATACAGGTATCTTGAGACTTAGAGGATTACCGTTCT
CAGCAGGAAAGGAAGACATACTTGACTTCTTCAAAGATTTCGAGCTGTCTGAAGACTTTGTTCATGTTACTGTTAATGGT
GAAGGGAGACCCACTGGGGAAGCTTTTGTGGAGTTTAGGAATGCAGAAGATTCACGAGCTGCAATGGTTAAGGATAGGAA
GACGCTTGGCAGCCGTTACATAGAATTGTTTCCTTCATCGGTTGAGGAGTTAGAGGAGGCACTATCAAGAGGAAGATGA