Details for Arabidopsis Locus AT3G20880

Position : Chr3 ( 5`- 7313538 .. 7315883 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20880

Protein [Map View]
MLFSTVLSHRTLYILTCPNTLIHSYTHPHIHAYLAFTGFLTQLHHLEISCLLLLFFSLSSLLKLMADPDCIFRNGYVDYY
NYSFNYATSLSRIYNSHDSFYYPHQTTNPNINENPNLTSPDSPPLREALPLLSLSPIHKHQEPTANHHEYYFMETTETSS
NSNFLDQCQDSYRHDVTVDLHLGLPNLGDGGSSSSDVVLDSTDHQEGHHDHHQDQGLEVTMASDHDDEHGGLQRGNHLHH
FWIPTPSQILMGPTQFSCPLCFKTFNRYNNMQMHMWGHGSQYRKGPESLRGTQPTAMLKLPCYCCAPGCKNNIDHPRARP
LKDFRTLQTHYKRKHGVRPFACRRCGKAFAVKGDWRTHEKNCGKLWYCSCGSDFKHKRSLKDHVKAFGNGHVPCCGIDHE
EEEAASDVEQQE*

DNA
ATGCTATTTTCCACTGTTTTGTCACATCGCACCTTATATATACTCACATGTCCTAATACACTCATACACTCATACACACA
CCCACATATACATGCATATCTAGCTTTCACTGGTTTCTTAACACAACTCCATCATCTAGAGATATCTTGCCTTCTTCTTC
TTTTTTTCTCACTATCTTCTCTCCTAAAGTTAATGGCTGATCCAGATTGTATCTTCAGAAATGGATATGTAGACTACTAT
AACTATAGCTTCAACTATGCCACTTCCCTCTCACGCATCTACAACTCTCATGACAGCTTTTATTATCCTCACCAGACGAC
AAACCCAAACATCAACGAAAACCCTAATTTGACTTCACCTGACTCTCCTCCACTTAGAGAAGCCCTCCCTCTCCTTAGCT
TAAGCCCCATTCATAAGCATCAAGAACCTACTGCTAACCACCATGAGTACTATTTCATGGAGACGACAGAAACTTCCTCT
AATTCAAACTTTCTTGATCAATGCCAAGACAGTTATCGTCATGATGTAACCGTGGATCTTCATCTAGGGTTACCAAACCT
CGGTGATGGTGGAAGCAGCAGCAGCGATGTGGTCCTTGATTCCACCGACCACCAAGAGGGTCACCATGATCATCATCAAG
ATCAAGGACTTGAAGTTACTATGGCTTCTGACCATGATGATGAACATGGTGGCTTACAAAGGGGTAATCATCTTCATCAC
TTTTGGATCCCGACTCCTTCTCAGATTCTGATGGGTCCAACACAGTTCTCTTGTCCTCTATGCTTCAAGACTTTCAACAG
ATACAACAACATGCAAATGCACATGTGGGGACATGGTTCACAATACAGAAAAGGACCGGAGTCGCTGAGAGGGACACAAC
CAACGGCGATGCTGAAGCTGCCTTGCTACTGCTGTGCACCGGGCTGCAAGAACAACATAGACCACCCAAGGGCTAGGCCG
CTCAAGGACTTCCGTACGCTTCAGACACATTACAAGCGGAAGCACGGTGTGAGGCCCTTTGCTTGTCGTAGGTGTGGGAA
GGCATTTGCGGTCAAAGGAGATTGGAGGACTCACGAGAAGAACTGTGGGAAGCTATGGTATTGCTCATGTGGGTCGGATT
TTAAGCACAAGAGGTCACTTAAAGACCACGTTAAGGCCTTTGGGAATGGTCATGTCCCTTGTTGTGGAATTGATCATGAG
GAAGAGGAGGCTGCTTCTGATGTCGAGCAGCAAGAATGA