Details for Arabidopsis Locus AT3G20840

Position : Chr3 ( 5`- 7300675 .. 7303693 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20840

Protein [Map View]
MNSNNWLGFPLSPNNSSLPPHEYNLGLVSDHMDNPFQTQEWNMINPHGGGGDEGGEVPKVADFLGVSKPDENQSNHLVAY
NDSDYYFHTNSLMPSVQSNDVVVAACDSNTPNNSSYHELQESAHNLQSLTLSMGTTAGNNVVDKASPSETTGDNASGGAL
AVVETATPRRALDTFGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQSRKGRQVYLGGYDKEDKAARSYDLAALKYWGP
STTTNFPITNYEKEVEEMKHMTRQEFVAAIRRKSSGFSRGASMYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFSTEEEA
AEAYDIAAIKFRGLNAVTNFEINRYDVKAILESSTLPIGGGAAKRLKEAQALESSRKREAEMIALGSSFQYGGGSSTGSG
STSSRLQLQPYPLSIQQPLEPFLSLQNNDISHYNNNNAHDSSSFNHHSYIQTQLHLHQQTNNYLQQQSSQNSQQLYNAYL
HSNPALLHGLVSTSIVDNNNNNGGSSGSYNTAAFLGNHGIGIGSSSTVGSTEEFPTVKTDYDMPSSDGTGGYSGWTSESV
QGSNPGGVFTMWNE*

DNA
ATGAATTCTAACAACTGGCTTGGCTTTCCTCTTTCACCGAACAACTCTTCTTTGCCTCCTCATGAATACAACCTTGGCTT
GGTCAGCGACCATATGGACAACCCTTTTCAAACACAAGAGTGGAATATGATCAATCCACACGGTGGAGGAGGAGATGAAG
GAGGAGAGGTTCCAAAAGTGGCCGATTTTCTCGGTGTGAGCAAACCGGACGAAAACCAATCCAACCACCTAGTAGCTTAC
AACGACTCAGACTACTACTTCCATACCAATAGCTTGATGCCTAGCGTCCAATCAAACGATGTCGTTGTAGCAGCTTGTGA
CTCCAATACTCCTAACAACAGTAGCTATCATGAGCTTCAAGAGAGTGCTCACAATCTACAGTCACTTACTTTGTCCATGG
GGACCACCGCTGGTAATAATGTTGTAGACAAAGCTTCACCATCCGAGACCACCGGGGATAACGCTAGCGGTGGAGCACTA
GCCGTTGTTGAGACGGCCACGCCAAGACGTGCATTGGACACTTTCGGACAACGAACCTCGATCTATCGTGGTGTCACAAG
ACATCGATGGACTGGTCGATATGAGGCTCATCTATGGGATAATAGTTGTAGAAGGGAAGGCCAGTCTAGGAAAGGAAGAC
AAGTTTACTTGGGTGGATATGACAAAGAAGATAAAGCAGCAAGATCATATGATCTAGCTGCACTTAAGTACTGGGGTCCT
TCAACTACTACTAATTTCCCCATTACAAACTACGAGAAAGAAGTAGAGGAAATGAAGCACATGACGAGACAAGAGTTCGT
GGCTGCCATTAGAAGGAAAAGTAGTGGATTTTCGAGAGGCGCTTCGATGTATCGAGGAGTTACAAGGCATCACCAACATG
GAAGATGGCAAGCAAGGATCGGCCGAGTCGCCGGAAACAAAGACCTCTACTTGGGAACTTTTAGCACTGAGGAAGAAGCA
GCAGAAGCTTACGATATAGCTGCAATAAAGTTTAGAGGACTTAATGCAGTGACCAACTTCGAGATCAACCGGTACGACGT
GAAAGCCATTCTAGAGAGTAGCACTCTTCCCATCGGAGGAGGCGCAGCTAAACGGCTCAAAGAAGCTCAAGCTCTTGAGT
CTTCAAGGAAACGCGAGGCGGAGATGATAGCCCTTGGTTCAAGTTTCCAGTACGGTGGTGGCTCGAGCACAGGCTCTGGC
TCCACCTCATCAAGACTTCAGCTTCAACCTTACCCTCTAAGCATTCAACAACCATTAGAGCCTTTTCTATCTCTTCAGAA
CAATGACATCTCTCATTACAACAACAACAATGCTCACGATTCCTCCTCTTTTAATCACCATAGCTATATCCAGACACAAC
TTCATCTCCACCAACAGACCAACAATTACTTGCAGCAACAGTCGAGCCAGAACTCTCAGCAGCTCTACAATGCGTATCTT
CATAGCAATCCGGCTCTGCTTCATGGACTTGTCTCTACCTCTATCGTTGACAACAATAATAACAATGGAGGCTCTAGTGG
GAGCTACAACACTGCAGCATTTCTTGGGAACCACGGTATTGGTATTGGGTCCAGCTCGACTGTTGGATCGACCGAGGAGT
TTCCAACCGTTAAAACAGATTACGATATGCCTTCCAGTGATGGAACCGGAGGGTATAGTGGTTGGACCAGTGAGTCTGTT
CAGGGGTCAAACCCTGGTGGTGTTTTCACTATGTGGAATGAGTAA