Details for Arabidopsis Locus AT3G20830

Position : Chr3 ( 5`- 7284963 .. 7286260 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20830

Protein [Map View]
MEPSPSSPPSSPPEILDLDSIKALKILGKGATGTVFLAHDVVSTSSSSSPFAVKLVPKSSASSLRRARWEIEVLRRLSVD
SNQNPFLPRLLASFESPEYFAWAVPYCSGGDLNVLLHRQNDGVFSSSVIRFYVAEIVCALEHLHTMGIAYRDLKPENILI
QQSGHVTLTDFDLSRSLKKPLRPHFYQPDPELIIDRKKSRSFSRLISPTAEKNKTGLKKTRSARVNPINRRKTSFSSGER
SNSFVGTDEYVSPEVIRGDGHDFAVDWWALGVLTYEMMYGETPFKGKSKKETFRNVLMKEPEFAGKPNDLTDLIRRLLVK
DPNRRLGCHRGAAEIKELAFFAGVRWDLLTEVLRPPFIPLRDDGELTVGGFDIREHFEKLRTTPSSAPPSPLRSPPHVCR
KNDPFIEF*

DNA
ATGGAGCCATCACCGTCGTCCCCACCATCATCACCGCCGGAGATTCTCGACCTTGACTCTATCAAAGCTCTCAAAATCCT
CGGTAAAGGCGCCACAGGTACCGTCTTCCTCGCGCACGACGTCGTTTCAACCTCTTCTTCTTCTTCTCCCTTCGCGGTCA
AGCTCGTCCCCAAATCCTCTGCTTCCTCTCTCCGCCGTGCACGGTGGGAAATCGAGGTCCTCCGTCGTCTCTCCGTTGAC
TCTAATCAAAACCCTTTTCTTCCACGTCTCTTAGCTTCTTTTGAGTCACCGGAATACTTTGCTTGGGCCGTCCCTTATTG
TTCCGGCGGTGATCTTAATGTACTTCTTCATCGTCAAAACGACGGCGTTTTCAGTTCCTCTGTTATTAGATTCTACGTGG
CGGAGATCGTCTGTGCGCTTGAGCATCTTCATACCATGGGGATCGCTTACAGAGACTTAAAACCAGAGAACATTCTGATT
CAGCAATCCGGTCACGTTACCTTAACCGATTTTGACCTTTCTCGGAGCCTTAAAAAACCCCTCCGACCCCATTTCTATCA
ACCCGACCCGGAATTGATAATCGATCGTAAAAAAAGTCGGAGCTTTTCTCGGTTGATCTCGCCGACGGCGGAGAAAAACA
AAACAGGGTTGAAGAAAACAAGATCCGCTCGGGTTAACCCAATTAATCGCCGGAAAACGAGTTTCTCCTCCGGTGAACGT
TCTAACTCATTTGTTGGAACGGACGAGTACGTCTCGCCGGAGGTAATTCGCGGCGACGGTCACGACTTCGCCGTCGATTG
GTGGGCTCTTGGCGTTTTGACATACGAGATGATGTATGGAGAGACGCCGTTCAAGGGTAAGAGCAAGAAGGAGACTTTTC
GTAACGTGTTGATGAAGGAACCCGAGTTCGCCGGAAAACCCAACGACCTCACTGATTTGATCCGGCGGTTACTGGTGAAG
GATCCGAATAGAAGGTTAGGTTGCCACCGTGGCGCGGCGGAGATAAAAGAGCTCGCTTTTTTCGCGGGTGTGAGGTGGGA
TTTGTTAACGGAGGTGTTACGACCTCCGTTTATTCCGTTAAGAGATGACGGAGAGTTAACGGTAGGTGGGTTTGATATAA
GGGAACATTTTGAGAAACTGAGGACGACGCCATCATCAGCTCCTCCGTCACCGTTACGTTCTCCGCCGCACGTGTGTCGT
AAAAACGATCCGTTTATTGAATTCTAA