Details for Arabidopsis Locus AT3G20810

Position : Chr3 ( 5`- 7275674 .. 7278379 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G20810

Protein [Map View]
MSGATTASSGDHNNLRLPTPTLDAESQTLLQSISAEGGYAYARMAVLAVAGDQSAAEAARDMAWEQLHSGPWHSVLPVWR
DAYSMACLHVAKIHFAAGEFGEALGALDMGLIMGGMLLRKDLHDSVLLVSSEARKMTKSLEEASGDFKGERLVPEVPVDV
NEVRHVLANLQLLVLKILPCRSLTCKRVEKRSGLSLEGFLRDYYLPGTPVVITNSMAHWPARTKWNHLDYLNAVAGNRTV
PVEVGKNYLCSDWKQELVTFSKFLERMRTNKSSPMEPTYLAQHPLFDQINELRDDICIPDYCFVGGGELQSLNAWFGPAG
TVTPLHHDPHHNILAQVVGKKYIRLYPSFLQDELYPYSETMLCNSSQVDLDNIDETEFPKAMELEFMDCILEEGEMLYIP
PKWWHYVRSLTMSLSVSFWWSNEAESSSS*

DNA
ATGTCAGGAGCTACCACCGCTTCCTCCGGAGACCACAACAACCTCCGTCTCCCAACTCCGACGCTTGACGCCGAATCGCA
AACTCTGCTGCAATCGATTTCTGCTGAAGGGGGTTACGCTTATGCTCGCATGGCGGTGTTAGCGGTGGCCGGTGACCAAA
GCGCGGCGGAGGCGGCGCGTGATATGGCTTGGGAGCAACTTCACTCTGGTCCGTGGCACTCGGTTCTCCCCGTTTGGCGC
GACGCTTACTCAATGGCTTGTCTCCACGTAGCTAAAATCCATTTCGCCGCCGGCGAGTTTGGTGAGGCGCTTGGTGCGCT
TGATATGGGTCTTATCATGGGAGGTATGCTTCTCCGCAAGGATCTTCATGATTCTGTTTTGTTGGTCTCCTCTGAAGCTC
GTAAGATGACGAAGAGTCTTGAAGAAGCTTCTGGAGATTTCAAAGGTGAGAGATTGGTCCCGGAAGTTCCCGTCGACGTC
AATGAGGTGAGACATGTTTTGGCTAATCTACAATTACTTGTCCTTAAGATTCTACCTTGCAGGTCTTTAACTTGTAAAAG
AGTAGAGAAGAGGTCTGGTTTATCTTTGGAGGGGTTTCTGCGTGATTATTATCTGCCAGGTACACCAGTTGTTATAACCA
ATTCTATGGCTCATTGGCCAGCCAGGACCAAGTGGAATCACTTGGACTACCTCAATGCTGTTGCTGGTAACCGCACCGTT
CCCGTGGAGGTGGGGAAAAACTATTTGTGTTCTGATTGGAAGCAAGAGCTTGTGACATTTTCTAAGTTCCTTGAACGGAT
GCGGACCAATAAATCGTCTCCAATGGAGCCTACTTATCTTGCCCAGCATCCTTTGTTTGATCAGATAAATGAACTGAGAG
ATGATATATGTATTCCTGATTACTGTTTTGTCGGTGGTGGGGAACTCCAATCACTTAATGCATGGTTTGGCCCGGCTGGG
ACAGTTACTCCGTTACACCATGATCCACATCATAATATACTTGCTCAGGTTGTTGGCAAGAAGTATATAAGGCTTTACCC
ATCCTTCCTGCAAGACGAACTTTACCCTTACTCTGAGACAATGCTCTGCAACTCTAGTCAGGTTGATCTAGACAATATCG
ACGAAACCGAGTTCCCAAAGGCCATGGAGTTGGAGTTTATGGATTGTATTCTAGAAGAAGGTGAAATGTTGTACATCCCT
CCCAAATGGTGGCACTATGTCAGGTCCTTAACAATGAGTCTCTCGGTTAGCTTCTGGTGGAGCAATGAAGCAGAATCTTC
TAGCTCGTAG